Cellulaire internalisering van Penetratin peptiden en toepassing

Cellulaire internalisering van Penetratin peptiden
en toepassing voor DNA-transfecties
Cellular internalisation of Penetratin peptides
and application for DNA-transfections
(with English summary)
Proefschrift voorgelegd tot
het behalen van de graad van
doctor in de wetenschappen - biotechnologie
door
Bart Christiaens
geboren op 19 april 1977 te Zottegem
academiejaar 2003-2004
1
Promotor
Prof. Dr. Joël Vandekerckhove
voorzitter van de Vakgroep Biochemie, Faculteit Geneeskunde en
Gezondheidswetenschappen, Universiteit Gent
Co-promotor
Prof. Dr. Maryvonne Rosseneu
groepsleider van het Laboratorium voor Lipoproteïnechemie, Vakgroep
Biochemie, Faculteit Geneeskunde en Gezondheidswetenschappen, Universiteit
Gent
2
Inhoudstafel
Hoofdstuk 1.
Inleiding
1
1.1. De celmembraan als barrière tussen de cel en de
extracellulaire omgeving
2
1.1.1. De structuur en karakteristieken van lipidendubbellagen
3
1.1.2. De opname van metabolieten door eukaryote cellen
9
1.1.3. Het binnenbrengen van celvreemde hydrofiele moleculen
in eukaryote cellen
11
1.2. Celpenetrerende peptidevectoren voor de internalisering
van kleine moleculen
14
1.2.1. Penetratin: celpenetrerend peptide afgeleid van het
Antennapedia homeoproteïne
14
Homeoproteïnen: universele, essentiële transcriptiefactoren
14
Homeodomeinen: sterk geconserveerde structuren
15
Homeoproteïnen: niet alleen transcriptiefactoren, maar ook
onconventionele paracriene boodschappers
17
Penetratin: een peptide dat correspondeert met de Antennapedia
3de helix en op een endocytose-onafhankelijke manier wordt
opgenomen door cellen
20
De toepassingen van de Penetratin peptidevector
22
1.2.2. Andere celpenetrerende peptiden afgeleid van proteïne
transductie domeinen
27
Celpenetrerende peptiden afgeleid van HIV Tat
27
Celpenetrerende peptiden afgeleid van HSV VP22
28
3
1.2.3. Chimere celpenetrerende peptiden
29
Transportan
29
KLA Modelpeptide I en afgeleiden
30
MTS-NLS peptiden
30
1.2.4. De studie van de lipideninteracties van peptiden
32
De hydrofobe kern van oplosbare proteïnen
32
De ‘niet klassieke’ hydrofobe omgeving van lipidendubbellagen
33
De interacties van peptiden met lipidendubbellagen
34
Het belang van amfipaticiteit bij de insertie van peptiden
in membranen
35
De permeabilisatie van membranen door peptiden
37
De fusie van membranen door schuin georiënteerde
fusogene peptiden
39
De membraantranslocatie van Penetratin
42
1.3. Polymeervectoren voor DNA-transfecties
45
1.3.1. Polyethyleenimine: de protonenspons die cellen
transfecteert
47
1.3.2. Polymethacrylaten: vinylpolymeren voor DNA-transfectie
51
1.3.3. Biodegradeerbare polymeren voor DNA-transfectie
54
Hoofdstuk 2.
Doelstellingen
55
4
Hoofdstuk 3.
Studie van het internaliseringsmechanisme van
Penetratin peptiden
59
3.1. De interacties van Penetratin peptiden met de
lipidendubbellaag van vesikels
60
Penetratin peptiden vormen random gestructureerde monomeren
in buffer
61
De initiële binding van Penetratin peptiden met lipidendubbellagen
is elektrostatisch
61
De lipidenbinding induceert de α-helicale structuur van Penetratin
peptiden
63
De Penetratin helix interageert met de fosfolipidenhoofdgroepen
64
Penetratin peptiden bevinden zich in het water-lipiden grensvlak
van fosfolipidendubbellagen
66
Het hydrofoob effect speelt een belangrijke rol bij de destabilisatie
van fosfolipidendubbellagen door Penetratin peptiden
3.2. De interacties van Penetratin peptiden met cellen
Penetratin peptiden zijn niet toxisch voor cellen
66
69
69
Penetratin peptiden worden zowel door endocytose als door
membraantranslocatie opgenomen
69
Trp48 en de hydrofobe omgeving van Trp56 spelen een belangrijke
rol bij de opname van Penetratin peptiden
3.3. Bijlagen
72
73
5
Hoofdstuk 4.
Toepassing van Penetratin voor DNA-transfectie
74
4.1. Penetratin-DNA complexen transfecteren niet
75
4.2. De endolysosomale lokalisatie van polymethacrylaat-DNA
complexen verklaart hun lage transfectie-efficiëntie
75
4.3. Penetratin verhoogt de transfectie-efficiëntie van
polymethacrylaat-DNA complexen
4.4. Bijlagen
78
80
Hoofdstuk 5.
Samenvatting en besluiten
81
English summary
87
Publicatielijst - List of publications
92
Dankwoord - Acknowledgements
93
Literatuurverwijzingen - References
95
6
Afkortingen
A
ABC
AEMA
AIBN
Ala
Antp
Arg
Asn
ATP
bp
CaCl2
Cdk
choline
CK2
Cos
alanine
ATP-bindende cassette
aminoëthyl-methacrylzuur
(azobis)isobutyronitrile
alanine
Antennapedia
arginine
asparagine
adenosine 5’-trifosfaat
baseparen
calcium chloride
Eng. Cycline Dependent Kinase
(2-hydroxyethyl)trimethyl ammonium
Caseïne Kinase 2
fibroblastachtige cellijn die afstamt van CV-1 niercellen uit de groene
meerkataap en die getransformeerd is met het SV40 viraal T-antigen
CPP
celpenetrerende peptiden
CURL
Eng. compartment of uncoupling of receptor and ligand
Cys
cysteïne
DMPA
1,2-dimyristoyl-sn-glycero-3-fosfaat
DMAEMA dimethyl-aminoëthyl-methacrylzuur
DNA
desoxyribonucleïnezuur
DOPE
1,2-dioleoyl-sn-glycero-3-fosfo-ethanolamine
F
fenylalanine
FGF
Fibroblast Groeifactor
Gln
glutamine
GTP
guanosine 5’-trifosfaat
<H0>
gemiddelde hydrofobiciteit
HENIMA
(hydroxyethyl)nicotinamide-methacrylzuur
HIV
Humaan Immunodeficiëntie Virus
HYMIMMA methyl-imidazoyl-methyl-methacrylzuur
I
isoleucine
ICAM
intercellulair adhesie molecule
Ile
isoleucine
IPEC
inter-poly-elektrolietcomplex
K
lysine
kb
kilobasen
Lys
lysine
LUV
Eng. large unilamellar vesicles
MA
methacrylzuur, Eng. methacrylic acid
MDCK
Madin Darby Cocker Spaniel Kidney cellen, epitheelachtige cellijn die
afstamt van niercellen uit de hond
Met
methionine
7
MHC
MLV
MTS
<µH>
N
NaCl
NBD
NCAM
NES
NLS
NMR
P
PA
PC
PE
PEG
PEI
PG
PKB
PKC
PI
PLL
PNA
PS
PSA
PTD
Q
R
RNA
S
SUV
Tat
TFE
TNF
VP22
W
Eng. Major Histocompatibility Complex
Eng. multilamellar vesicles
Eng. membrane translocating sequence
helicaal hydrofoob moment
asparagine
natrium chloride, keukenzout
nitrobenz-2-oxa-1,3-diazol-4-yl
Neurale Cel Adhesie Molecule
nucleaire export sequentie
nucleaire lokalisatie sequentie
nucleaire magnetische resonantie
proline
fosfatidinezuur
fosfatidylcholine
fosfatidylethanolamine
polyethyleenglycol
polyethyleenimine
fosfatidylglycerol
Proteïne Kinase B
Proteïne Kinase C
fosfatidylinositol
poly-L-Lysine
peptide nucleïnezuren (Eng. peptide nucleic acid)
fosfatidylserine
polysiaalzuur
proteïne transductie domein
glutamine
arginine
ribonucleïnezuur
serine
Eng. small unilamellar vesicles
Transactivator, transcriptie activeringsfactor van het Humaan
Immunodeficiëntie Virus (HIV)
trifluoro-ethanol
Tumor Necrose Factor
Viraal Proteïne 22 van het Herpes virus
tryptofaan
8
1
Inleiding
1
1.1. De celmembraan als barrière tussen de cel en de
extracellulaire omgeving
Therapeutische behandelingen hebben als doel om farmaceutica aan een bepaalde
concentratie, op een niet-toxische en reproduceerbare wijze bij doelcellen te brengen.
Bij de meeste behandelingen moeten de farmaceutica interageren met intracellulaire
componenten, waardoor de efficiëntie van de therapie voornamelijk bepaald wordt
door de efficiëntie waarmee de actieve component in de cellen wordt geïnternaliseerd.
De internalisering van farmaceutica vereist echter het doorkruisen van de
plasmamembraan (of celmembraan). De plasmamembraan is een cellulair sterk
gedifferentieerde en complexe structuur, die hoofdzakelijk uit een lipidendubbellaag en
proteïnen bestaat (Darnell et al., 1986; Alberts et al., 1994). Door haar hydrofobe
karakter vormt de plasmamembraan een beschermende, semi-permeabele barrière
tussen de cel en de extracellulaire omgeving.
Deze barrière verhindert de
ongecontroleerde opname van celvreemde stoffen en de ongecontroleerde uitscheiding
van essentiële moleculen zoals glucose, aminozuren en lipiden.
De selectieve
permeabiliteit van de plasmamembraan zorgt dus voor een regulatie van de interne
cellulaire samenstelling.
Daarnaast bezitten cellen ook selectieve importmechanismen voor de opname van
componenten die nodig zijn voor hun metabolisme. De opname-efficiëntie van
celvreemde stoffen is echter laag door de selectiviteit van de importmechanismen en
door de afbraak van moleculen die via endocytose werden opgenomen (cf. infra). De
efficiënte internalisering van celvreemde hydrofiele moleculen (zoals peptiden,
proteïnen, oligonucleotiden, DNA, peptide nucleïnezuren (PNA)) en farmaceutica in
levende cellen blijft tot op heden dan ook een belangrijke uitdaging voor onderzoekers
en voor de farmaceutische industrie (Orive et al., 2003).
De karakteristieken van de lipidendubbellaag van de plasmamembraan en de
mechanismen waarover cellen beschikken voor opname van levensnoodzakelijke
componenten worden in deze inleiding beschreven. Daarna volgt een uiteenzetting van
de totnogtoe gekende technieken voor de internalisering van celvreemde moleculen.
2
1.1.1. De structuur en karakteristieken van lipidendubbellagen
Biologische membranen bestaan uit een lipidendubbellaag die aan de membraan haar
karakteristieke eigenschappen verleent. De belangrijkste componenten van deze
lipidendubbellaag zijn (glycero)fosfolipiden, sfingolipiden en cholesterol. Deze
lipiden zijn asymmetrisch verdeeld over de binnenste en buitenste laag van de
plasmamembraan (Vance en Vance, 1991).
(Glycero)fosfolipiden
Glycerofosfolipiden, meestal kortweg fosfolipiden genoemd, zijn amfifiele moleculen
bestaande uit glycerol, waarvan twee alcoholfuncties veresterd zijn met een vetzuur en
het derde met fosfaatgroep (Fig. 1-A). De zogenaamde hydrofiele hoofdgroep van het
fosfolipide omvat de fosforgroep waarop twee hydrofobe acylketens bevestigd zijn.
In waterig milieu vormen fosfolipiden spontaan macromoleculaire structuren
(micellen, dubbellagen of omgekeerde micellen).
Hierbij zijn de hydrofiele
hoofdgroepen naar de waterige fase gericht, terwijl de hydrofobe acylketens naar
elkaar georiënteerd zijn.
De gevormde macromoleculaire structuur is afhankelijk van de relatieve grootte van de
fosfolipidehoofdgroep ten opzichte van de acylketens (Fig. 2). Fosfolipiden worden op
basis van deze eigenschappen onderverdeeld.
Cilindrische lipiden, zoals
fosfatidylcholine (PC) waarvan de acylketens meer dan 10 koolstofatomen lang zijn,
vormen dubbellagen in water. De omgekeerd conische lipiden, zoals lysofosfolipiden,
vormen
bij
voorkeur
micellen,
terwijl
de
conische
lipiden,
zoals
fosfatidylethanolamine (PE), bij voorkeur omgekeerde micellen of de hexagonale HII
fase vormen. De aanwezigheid van conische en omgekeerd conische fosfolipiden
veroorzaakt spanningen in lipidendubbellagen. Deze spanningen zijn bepalend voor de
stabiliteit van lipidendubbellagen en voor de interacties van deze lipidenstructuren met
peptiden en proteïnen.
Fosfolipiden worden ook onderverdeeld op basis van hun netto lading.
Fosfatidylcholine en fosfatidylethanolamine zijn zwitterionische fosfolipiden, terwijl
fosfatidinezuur (PA), fosfatidylglycerol (PG), fosfatidylserine (PS) en
fosfatidylinositol (PI) negatief geladen zijn (Fig. 1).
3
X
A
X = -H
O
O
P
O
H2C
H
|
C
O
O
O
-
-CH2-CH2-NH3+
fosfatidylethanolamine (PE)
-CH2-CH2-N+(CH3)3 fosfatidylcholine (PC)
CH2
O=C O=C
-CH2-CH-CH2-OH
|
OH
fosfatidylglycerol (PG)
-CH2-CH-NH3+
|
COO-
fosfatidylserine (PS)
OH
|
|
|
OH
CH2-CH2-N+(CH3)3
B
fosfatidinezuur (PA, Eng. fosfatidic acid)
O
O
P
HO
|
HC
H
|
C
O
HC
NH
HC
O
-
CH2
C=O
OH
|
fosfatidylinositol (PI)
|
OH
|
OH
C
HO
Figuur 1. Structuur van fosfolipiden (A), sfingomyeline (B) en cholesterol (C).
De vetzuurketens van fosfolipiden uit de plasmamembraan zijn gemiddeld 16 tot 22
koolstofatomen lang en bevatten gemiddeld 1.1 à 1.5 cis-onverzadigde dubbele
bindingen. Het meest abundante fosfolipide is fosfatidylcholine (PC), dat vooral in de
buitenste laag van de plasmamembraan voorkomt.
De minder abundante
fosfatidylethanolamine (PE), fosfatidylserine (PS) en fosfatidylinositol (PI) komen
voornamelijk in de binnenste laag van de plasmamembraan voor (Vance en Vance,
1991).
4
Sfingolipiden
Sfingolipiden zijn amfifiele moleculen met een hydrofiele hoofdgroep op basis van
ceramide, gekoppeld met twee hydrofobe acylketens.
Sfingomyeline is het eenvoudigste sfingolipide en heeft, net als fosfatidylcholine, een
zwitterionische cholinehoofdgroep (Fig. 1-B).
Glycolipiden zijn sfingolipiden
waarvan de hoofdgroep gemodificeerd is met suikergroepen. De meest complexe zijn
de gangliosiden die negatief geladen zijn doordat ze siaalzuur bevatten.
Sfingolipiden uit de plasmamembraan hebben acylketens die gemiddelde 20 tot 26
koolstofatomen lang zijn en bevatten gemiddeld 0.35 à 0.1 cis-onverzadigde dubbele
bindingen. Ze komen overwegend aan de buitenkant van de plasmamembraan voor.
Figuur 2. De aggregatievormen van fosfolipiden.
5
Cholesterol
Cholesterol is de belangrijkste vertegenwoordiger van de steroïden in dierlijke
membranen. Het is een amfifiele molecule die bestaat uit een vlakke, hydrofobe
structuur die intercaleert tussen de acylketens van fosfo- en sfingolipiden, en een
hydrofiele hydroxylgroep, die naar de waterige fase gericht wordt (Fig. 1-C).
Cholesterol komt zowel aan de binnen- als aan de buitenzijde van de plasmamembraan
voor.
Fasetransities van lipiden
De transitietemperatuur wordt gedefinieerd als de temperatuur waarbij fosfolipiden
overgaan van de vaste gel fase met geordende acylketens, naar de ongeordende
vloeibare fase, waarbij de acylketens kunnen bewegen in het hydrofobe gedeelte van
de lipidendubbellaag (Fig. 3).
Figuur 3. Overzicht van de verschillende fysische fasen waarin fosfo- en sfingolipiden kunnen
voorkomen.
6
De transitietemperatuur wordt bepaald door het hydrofoob effect dat heerst tussen de
acylketens. Ze neemt bijgevolg toe met de lengte van de acylketens en neemt af bij
een toenemend aantal dubbele bindingen in de acylketens. Natuurlijke sfingolipiden
bevatten preferentieel verzadigde acylketens en hebben dus een hogere
transitietemperatuur dan fosfolipiden, die meer onverzadigde vetzuren bevatten.
De intercalatie van cholesterol in lipidendubbellagen kan een tweevoudig effect
hebben op de fasetransitie van fosfolipiden. In een membraan in de vaste gel fase
verzwakt cholesterol het hydrofoob effect tussen de acylketens, waardoor de
transitietemperatuur afneemt. Omgekeerd verhoogt cholesterol het hydrofoob effect
tussen de acylketens in een ongeordende vloeibare membraan, waardoor de
transitietemperatuur toeneemt.
Vesikels als model voor lipidendubbellagen
Voor de fysicochemische studie van de interacties van peptiden en proteïnen met
lipidendubbellagen, worden vesikels of liposomen als modelmembranen gebruikt.
Vesikels vormen de beste modelstructuur voor de lipidendubbellagen van
celmembranen. Ze kunnen gemakkelijk met een gekende lipidensamenstelling bereid
worden (cf. bijlage 3 van hoofdstuk 3). In tegenstelling tot celmembranen, zijn de
lipiden van modelmembranen symmetrisch verdeeld over beide lagen van de
lipidendubbellaag.
De lipidendubbellaag van celmembranen
Volgens het model van Singer en Nicholson (Alberts et al., 1994) bestaan
celmembranen uit een lipidendubbellaag die een tweedimensionele, vloeibare mozaïek
vormt, waarin proteïnen ingebed zijn en waarbij de lipiden en proteïnen voornamelijk
lateraal bewegen. Door de aanwezigheid van negatief geladen fosfolipiden en
glycolipiden, is de plasmamembraan netto negatief geladen.
Op basis van de fysische eigenschappen van fosfolipiden, sfingolipiden en cholesterol,
werd recent aangetoond dat de plasmamembraan georganiseerd is als een mozaïek van
subdomeinen (Harder en Simons, 1997). De hydroxylgroep van cholesterol interageert
beter met de ceramide en suiker bevattende hoofdgroepen van sfingo- en glycolipiden,
7
dan met de glycerol bevattende hoofdgroep van fosfolipiden. In fysiologische
membranen clustert cholesterol daarom preferentieel rond sfingolipiden. De vlakke
ringstructuur van cholesterol intercaleert bovendien gemakkelijker tussen de lange,
verzadigde acylketens van sfingolipiden, waarin een groter hydrofoob effect heerst.
Ten gevolge van de clustering van cholesterol rond sfingolipiden, ontstaan rigide
membraandomeinen die vlotten (rafts) vormen, waarin proteïnen verankerd zitten. De
rigide rafts bewegen lateraal in een fluïde zee die voornamelijk uit onverzadigde
fosfolipiden bestaat (Harder en Simons, 1997; Harder et al., 1998; Shogomori en
Brown, 2003). Door deze organisatie kunnen rafts belangrijk zijn voor het clusteren
van signalisatiemoleculen. Dit resulteert in een efficiënte signaaltransductie (Pierce,
2004). Daarnaast zouden rafts ook een rol spelen bij het sorteren van lipiden en
proteïnen tijdens de secretie via het Golgi-apparaat (Simons en Ikonen, 1997; Brown
en London, 1998).
Caveolae zijn rafts die Caveoline proteïnen bevatten en gladde, flesvormige
instulpingen in de plasmamembraan vormen.
Caveolae komen veel voor in
adipocyten, endotheel- en spiercellen, terwijl ze niet detecteerbaar zijn in lymfocyten
en neuronale cellen. De rol van caveolae is nog onduidelijk, alhoewel men vermoedt
dat ze betrokken zijn bij een tot op heden nog ongekende vorm van endocytose (Parton
en Richards, 2003).
8
1.1.2. De opname van metabolieten door eukaryote cellen
De overleving van cellen vereist dat ze metabolieten kunnen uitwisselen met hun
omgeving.
Voor de opname van essentiële componenten ontwikkelden cellen
verschillende mechanismen (Darnell et al., 1986; Alberts et al., 1994) .
Kleine, ongeladen, hydrofiele moleculen zoals water, zuurstof of kooldioxide en
kleine, hydrofobe, wateroplosbare moleculen zoals ethanol, worden aspecifiek
opgenomen door passieve diffusie doorheen de lipidendubbellaag van de eukaryote
celmembraan.
De lipidendubbellaag is daarentegen impermeabel voor de meeste andere
wateroplosbare stoffen, zoals ionen, ATP, aminozuren, proteïnen, nucleosiden, enz.
Voor de opname van deze componenten ontwikkelden zich specifieke, selectieve
processen.
Ionen
en
kleine
wateroplosbare
moleculen
worden
opgenomen
via
transmembraanproteïnen die de lipidendubbellaag overbruggen. Kanaalproteïnen
vormen hydrofiele poriën in de lipidendubbellaag, zonder specifieke binding met het
substraat. Transmembranaire transportproteïnen (ook permeasen of carriers genoemd)
binden daarentegen het substraat op een specifieke manier. Kanaalproteïnen en
transportproteïnen zorgen voor passief transport (Eng. facilitated diffusion) als ze de
diffusie van het substraat van de zijde van de membraan met de hoogste concentratie
naar die met de laagste concentratie vergemakkelijken. Transportproteïnen doen ook
aan actief transport van het substraat, tegen de concentratiegradiënt in. Dit is mogelijk
door de import van het substraat te koppelen aan de import (symport) of export
(antiport) van een andere molecule of door koppeling aan ATP-hydrolyse (bvb. Na+K+ATPase of ABC transporters).
Macromoleculen, zoals proteïnen en grote partikels, worden door de cel opgenomen
via endocytose. Pinocytose is de constitutieve, aspecifieke opname van medium via
coated vesicles (cf. infra). Bij fagocytose worden grote deeltjes (debris van cellen,
micro-organismen,...) op een gereguleerde, specifieke en receptor gemedieerde manier
opgenomen via fagosomen.
Het best bestudeerde opnameproces is receptor gemedieerde endocytose, een complex
proces waarbij meerdere proteïnen betrokken zijn. De opgenomen moleculen binden
9
eerst met een hoge specificiteit op een receptor op het celoppervlak. Bijgevolg
groeperen de receptoren zich op het celoppervlak, terwijl aan de cytoplasmatische zijde
een proteïnekapsel wordt gevormd, dat voornamelijk uit Clathrine bestaat. Vervolgens
ontstaan instulpingen in de membraan (coated pits), die zich afsnoeren en coated
vesicles met extracellulair medium en het geëndocyteerde materiaal vormen. Na het
afwerpen van de Clathrine mantel, ontstaan naakte, gladde endosomen met een
diameter van 100 tot 200 nm, die naar de perinucleaire regio van de cel migreren. De
inhoud van de vroege endosomen verzuurt (pH 6.2) door de import van protonen (H+)
en door de export van water door transmembranaire pompen. Dit gebeurt in het
compartment of uncoupling of receptor and ligand (CURL), waarin ligand en receptor
dissociëren en waarin de opgeloste moleculen geconcentreerd worden. De receptoren
en lipiden worden gerecycleerd aan het celoppervlak. Tenslotte versmelten de late
endosomen (pH 5.5) met lysosomen. Daar wordt de endosomale inhoud afgebroken
door de lysosomale hydrolasen, die optimaal functioneren bij lage pH.
Het
endosomale opnameproces duurt 15 tot 20 minuten en wordt, wegens het
energieverbruik dat eraan gekoppeld is (ATP en GTP), geblokkeerd bij 4°C (Robinson,
1994).
10
1.1.3.
Het binnenbrengen van celvreemde hydrofiele moleculen in
eukaryote cellen
De huidige methoden om de opname-efficiëntie van celvreemde moleculen te
verhogen, kunnen in twee klassen onderverdeeld worden: de directe transfermethoden
en de methoden die gebruik maken van celpermeabele vectoren (Stephens en
Pepperkok, 2001).
De directe transfermethoden zijn het meest efficiënt en berusten op het tijdelijk
verstoren van de integriteit van de eukaryote celmembraan, waardoor componenten uit
het extracellulaire medium in de cel kunnen diffunderen (Borasio et al., 1989; Potter,
1988; Aullo et al., 1993).
Micro-injectie met glascapillairen en elektroporatie worden vooral in vitro toegepast.
Microprojectielbombardement is een alternatieve techniek waarbij men cellen beschiet
met micropartikels die bedekt zijn met het substraat. Met deze techniek kunnen
tegelijkertijd meerdere cellen en verschillende celtypes, zowel in vitro als in vivo,
behandeld worden.
Microprojectielbombardement wordt vooral toegepast voor
gentherapie, als alternatief voor virale vectoren (Stephens en Pepperkok, 2001).
Celpermeabele vectoren vormen een alternatief voor de directe transfermethoden. In
analogie met het concept van ‘het paard van Troje’, wordt tijdens de opname van de
vector de daaraan gekoppelde cargomolecule mee opgenomen in de cel. Vooral met
het oog op gentherapie wordt dit type vectoren veel onderzocht. De spontane opname
van polynucleotiden door eukaryote cellen wordt immers verhinderd door de negatieve
lading, het grote hydrodynamische volume van het DNA en door de afbraak door
nucleasen (Bally et al., 1999; Garnett, 1999). Om deze problemen te vermijden,
worden polynucleotiden gecombineerd met een transfectievector.
Graham en van der Eb gebruikten in de jaren ’70 calciumfosfaat co-precipitatie voor
het binnenbrengen van DNA in cellen. Bij het mengen van een DNA/CaCl2 oplossing
met fosfaatbuffer, ontstaan DNA/Ca3(PO4)2 precipitaten die vermoedelijk via
11
endocytose door cellen worden opgenomen.
Deze techniek is echter weinig
reproduceerbaar en kan enkel in vitro toegepast worden (Graham en van der Eb, 1973).
Een tweede voorbeeld zijn de kationische liposomen, die frequent gebruikt worden
voor de introductie van RNA en DNA in levende cellen (Felgner et al., 1987; Axelrod
et al., 1998; Cullis en Chonn, 1998; Bally et al., 1999). De liposomen bestaan uit
positief geladen amfifiele lipiden die georganiseerd zijn als unilamellaire of
multilamellaire liposomen (cf. 1.1.1.). De elektrostatische interactie van de liposomen
met de negatief geladen fosfaat ruggengraat van nucleotiden, gaat gepaard met de
vorming van lipide-nucleotide complexen of lipoplexen. Hierbij worden de negatieve
ladingen van de nucleotiden geneutraliseerd en wordt hun volume verkleind. Door hun
netto positieve lading worden lipoplexen op een aspecifieke manier, door directe
interactie met de plasmamembraan of door endocytose opgenomen (Leventis en
Silvius, 1990; Behr, 1994; Felgner et al., 1994). Om de membraaninteracties te
verbeteren, bevatten liposomen naast de kationische lipiden ook dioleoylfosfatidylethanolamine (DOPE) (Ellens et al., 1986; Bentz et al., 1987) of worden ze
geconjugeerd met fusogene peptiden (Kato et al., 1991; Puyal et al., 1994; Lee et al.,
1996).
Hierdoor versmelten de liposomen gemakkelijker met de plasma- en
endosoommembraan, waardoor de vrijstelling van de cargo in het cytosol verhoogd
wordt.
Om celspecificiteit te bekomen, worden liposomen gekoppeld aan celspecifieke
liganden (bvb. peptiden, antilichamen, proteïnen, glycolipiden, suikergroepen,...)
(Stavridis et al., 1986; Ahmad et al., 1993; Yamauchi et al., 1994; Hart et al., 1995;
Remy et al., 1995; Mori et al., 1995; Barry et al., 1996). Liposomen worden ook
gebruikt om farmaceutica en proteïnen binnen te brengen in cellen (Gregoriadis, 1995;
Sells et al., 1995; Gregoriadis et al., 1999; Cullis en Chonn, 1998).
Virussen vormen gepaste vectoren voor gentherapie (Orive et al., 2003; Journal of
Gene Medicine website, 2004). Ze bestaan uit een kapsel dat is opgebouwd uit
proteïnen en/of lipiden en dat nucleotiden bevat. Virussen zijn voor hun replicatie
aangewezen op een gastheercel en bezitten daardoor mechanismen om nucleotiden op
een efficiënte wijze in cellen binnen te brengen.
12
Retrovirussen bestaan uit een proteïnencapside met enkelstrengig RNA (10kb), dat
omgeven is door een lipidenenveloppe. Na interactie met een celreceptor, worden de
virussen opgenomen door fusie van de virale lipidenenveloppe met de celmembraan.
De celspecificiteit kan gewijzigd worden door mutatie van het env gen (Kasahara et
al., 1994). Het enkelstrengig RNA wordt via omgekeerde transcriptie in het cytosol
omgezet naar dubbelstrengig DNA dat op een willekeurige plaats in het genoom van
de gastheercel wordt ingebouwd. Deze insertie is langdurig, maar houdt ook risico’s in
met betrekking tot oncogeniciteit. Doordat deze vector zowel in vitro als in vivo
gebruikt wordt voor infectie van delende cellen, is hij uitermate geschikt voor het
behandelen van tumoren (Roth et al., 1996; Glimm et al., 1997). Retrovirale
transfectievectoren kunnen transgenen tot 7.5kb bevatten (Verma en Somia, 1997).
Adenovirussen bestaan uit een proteïnenkapsel en bevatten dubbelstrengig DNA
(35kb). Ze binden op celreceptoren (o.a. via MHC klasse I en Integrinen) en worden
via receptor gemedieerde endocytose opgenomen. Door de Penton componenten van
het virale kapsel ontsnapt het virus uit het endosoom en wordt het vrijgesteld in het
cytosol. De transgenen worden niet ingebouwd in het chromosomale DNA, maar
blijven als episoom in de celkern aanwezig. Adenovirale vectoren worden bijgevolg
enkel gebruikt voor transiënte transgen expressies, zowel in vitro als in vivo (Verma en
Somia, 1997). Adenovirale vectoren kunnen transgenen tot 30kb bevatten (Verma en
Somia, 1997).
Naast de hierboven beschreven vectoren omvatten celpermeabele vectoren ook
peptiden en synthetische polymeren. Deze vectoren werden in dit werk bestudeerd. In
de volgende paragrafen volgt een uitgebreide bespreking van deze vectoren.
13
1.2.
Celpenetrerende peptidevectoren voor de
internalisering van kleine moleculen
Celpenetrerende peptiden (CPP) zijn peptidevectoren van maximaal 40 aminozuren,
die via een schijnbaar energie-onafhankelijk mechanisme worden opgenomen door
cellen (Lindgren et al., 2000; Langel, 2002; Lundberg en Langel, 2003). CPP worden
vooral gebruikt als vector voor de internalisering van peptiden, nucleotiden en
farmaceutica in het cytosol en de nucleus van cellen. Afhankelijk van hun origine
worden ze ingedeeld in twee klassen. De eerste klasse omvat CPP die afgeleid zijn van
het domein dat verantwoordelijk is voor membraantranslocatie van proteïnen. Deze
CPP worden in de literatuur ook aangeduid met de term ‘proteïne transductie domein’
(PTD) (Mi et al., 2000; Schwarze et al., 2000; Waizenegger et al., 2002). De tweede
klasse CPP omvat de chimere peptiden.
1.2.1. Penetratin: celpenetrerend peptide afgeleid van het Antennapedia
homeoproteïne
Het best bestudeerde CPP is het Penetratin peptide (of pAntp43-58). Dit peptide is
afgeleid van het Antennapedia (Antp) homeoproteïne, een transcriptiefactor uit
Drosophila.
Homeoproteïnen: universele, essentiële transcriptiefactoren
Transcriptiefactoren zijn sequentiespecifieke DNA-bindende proteïnen die de
gentranscriptie reguleren door interactie met de doelgenen. Homeoproteïnen zijn
eukaryote transcriptiefactoren die gecodeerd worden door de homeoboxgenen. Ze
spelen een essentiële rol bij de embryonale ontwikkeling, in het bijzonder bij het
14
bepalen van de ontwikkelingspatronen van verschillende lichaamsdelen, bij het
bepalen van de cellulaire voorbestemming en bij andere fundamentele processen
(Gehring et al., 1994a en b). Homeoboxgenen komen echter niet alleen tot expressie
gedurende de vroegste ontwikkelingsstadia. Bepaalde van deze proteïnen komen
eerder laat tot expressie (bvb. in het zenuwstelsel) en sommigen zelfs gedurende de
volledige levenscyclus (Joliot et al., 1991a; Chatelin et al., 1996). In Drosophila komt
de clustering van de homeoboxgenen in chromosomale complexen overeen met de
volgorde waarmee ze tot expressie komen langs de antero-posterieure lichaamsas
(Kaufman et al., 1990).
Het homeodomein is het DNA-bindende domein van homeoproteïnen. Het omvat 60
aminozuren en is terug te vinden bij metazoa, fungi en planten en vertoont zelfs
sequentie- en structuurgelijkenissen met prokaryote DNA-bindende proteïnen (Gehring
et al., 1994b).
Een voorbeeld van de hoge graad van conservatie van de
aminozuursequentie vinden we bij het humaan Hox-A7 homeodomein, dat slechts in
één van de 60 aminozuren verschilt van het homologe Antp homeodomein van de
fruitvlieg Drosophila. Wanneer de sequenties van 346 homeodomeinen vergeleken
worden, is het opmerkelijk dat residu’s 44 tot 58 van het homeodomein zeer sterk
geconserveerd zijn (Fig. 1-A) (Gehring et al., 1994a).
Homeodomeinen: sterk geconserveerde structuren
De structuur van het Antp homeodomein in oplossing werd bepaald door NMR
spectroscopie (Otting et al., 1988; Qian et al., 1989; Billeter et al., 1990). Het
homeodomein bestaat uit een flexibele N-terminale arm, gevolgd door helix 1, een
loop, helix 2, een turn en helix 3. Helix 3 omvat onder andere de sterk geconserveerde
residu’s 43 tot 58 en is aan de C-terminus minder gestructureerd (dit gedeelte wordt
soms helix 4 genoemd, zie Fig. 4-A). Helix 2 vormt met helix 3 een helix-turn-helix
motief, dat kenmerkend is voor prokaryote DNA-bindende eiwitten. De structuur van
het helix-turn-helix motief van het Antp homeodomein komt dan ook goed overeen
met de ruggengraatstructuur van verschillende prokaryote genregulerende proteïnen
(Gehring et al., 1990). De moleculaire architectuur van het homeodomein wordt
15
samengehouden door een kern van 11 geconserveerde aminozuren (Fig. 4-A), waarvan
de meeste hydrofoob zijn (o.a. Trp48 en Phe49 die in de helix 3 vervat zijn, cf. infra).
A
1
10
|
20
|
N-terminale arm
30
|
helix 1
40
|
loop
50
|
helix 2
turn
60
|
helix 3
|
(helix 4)
RKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEN
d dd d
k k
dk d d kk kk k ddk dkkdddddd
B
Homeodomein
DNA
Helix 3
Helix 2
Helix 1
Helix 2
Helix 3
Helix 1
DNA
Homeodomein
Figuur 4.
A, De aminozuursequentie van het Antennapedia homeodomain (1-60), zoals weergegeven door
Gehring et al. (Gehring et al., 1994a). De positief geladen residu’s zijn weergegeven in blauw,
de aromatische residu’s in groen. De onderlijnde residu’s zijn meer dan 80% geconserveerd bij
346 homeodomeinen. De belangrijkste structurele kenmerken zijn: k, aminozuur behorend tot de
proteïnekern; d, aminozuur dat betrokken is bij DNA-binding (vet gedrukt staat voor aminozuren
die specifiek contact maken met een DNA base).
B, De NMR structuur van het C39S Antennapedia homeodomein dat gecomplexeerd is met zijn
herkennings DNA (pdb code 1ahd). Helix 3 van het homeodomein, of de herkenningshelix, is
aangeduid in rood.
16
De structuur van het Antp homeodomein, gebonden op de DNA herkenningssequentie,
werd bepaald door NMR spectroscopie (Fig. 4-B) en X-straalkristallografie en vertoont
grote gelijkenissen met de proteïnestructuur in oplossing (Gehring et al., 1994a;
Fraenkel en Pabo, 1998). De sterk geconserveerde derde helix van het homeodomein
bindt specifiek op de 5'-TAATGG-3'-sequentie in de grote groef van het DNA en
wordt daarom de herkenningshelix genoemd. De talrijke positief geladen residu's van
de derde helix, waaronder de C-terminale arginine en lysine residu’s, interageren
aspecifiek met de ribosefosfaat ruggengraat van de dubbele DNA-helix. De Nterminale Ile47, Asn51, Gln50 en Met54 residu’s van de derde helix zorgen voor de
sequentiespecificiteit bij de DNA-binding (Gehring et al., 1994b; Fraenkel en Pabo,
1998). Gln50 en Met54 zijn sterk geconserveerd en worden beschouwd als de
hoofddeterminanten voor de DNA-bindingspecificiteit van het homeodomein (Le Roux
et al., 1993; Gehring et al., 1994b; Pellizzari et al., 1997). De N-terminale arm van het
homeodomein zorgt voor additionele, specifieke interacties met bepaalde basen in de
kleine groef van het DNA (Arg5 en Arg3), terwijl de loop tussen helix 1 en helix 2
aspecifiek interageert met de DNA ruggengraat aan de andere zijde van de grote groef.
Door het vergelijken van het Antp homeodomein met dat van Engrailed en andere
homeoproteïnen, werd aangetoond dat niet alleen de sequentie, maar ook de structuur
van homeodomeinen sterk geconserveerd is (Gehring et al., 1994a en b).
Homeoproteïnen:
niet
alleen
transcriptiefactoren,
maar
ook
onconventionele paracriene boodschappers
Homeoproteïnen worden op een onconventionele manier gesecreteerd en opgenomen
door cellen. Dit onconventionele intercellulair transport zou een tot op heden nog
ongekende vorm van paracriene signalisatie kunnen zijn (Fig. 5). Het mechanisme
voor opname en secretie en het fysiologisch belang zijn nog niet volledig ontrafeld en
worden nog bestudeerd (Joliot en Prochiantz, 2004).
17
Figuur 5. Schematische voorstelling van het onconventionele intercellulair transport van
homeoproteïnen bij dierlijke cellen, met aanduiding van de signalen die daarbij betrokken zijn
(HD, homeodomein; NES, nucleaire export sequentie; NLS, nucleaire lokalisatie sequentie)
(Prochiantz en Joliot, 2003).
De onconventionele opname van homeoproteïnen
Dit fenomeen werd voor het eerst geobserveerd voor het Antp homeodomein op
neuronale cellen in cultuur. Deze opname gebeurt zowel bij 37°C als bij 4°C, wat
'klassieke' receptor gemedieerde endocytose uitsluit. De internalisering van het
homeodomein wordt bevorderd door de aanwezigheid van negatieve ladingen aan het
celoppervlak, zoals aangetoond voor de modificatie van NCAM met α -2,8polysiaalzuur (α-2,8-PSA) op het oppervlak van neuronale cellen (Joliot et al., 1991b;
Lindgren et al., 2000). De sterk geconserveerde derde helix van het homeodomein
18
zorgt voor de endocytose-onafhankelijke internalisering van het homeodomein in het
cytosol (Le Roux et al., 1993).
Bovendien bevat de C-terminus van de derde helix een nucleaire lokalisatie sequentie
(NLS, consensus sequentie: 4-8 aminozuren, rijk aan arginine en lysine), waardoor het
homeodomein naar de celkern wordt gebracht.
Het homeodomein bindt dan
competitief op de DNA bindingssites van endogene homeoproteïnen. Dit resulteert in
morfologische differentiatie van neuronale cellen in cultuur (Joliot et al., 1991a;
Bloch-Gallego et al., 1993; Le Roux et al., 1995).
Endocytose-onafhankelijke internalisering en nucleaire targetting werden ook voor
andere homeodomeinen en voor volledige homeoproteïnen (Fushi tarazu, Engrailed,
Hoxa-5 en Hoxc-8) geobserveerd.
Samen met de sterke conservatie van
homeodomeinen, wijst dit er dus op dat alle homeoproteïnen waarschijnlijk een
gemeenschappelijk internaliseringsmechnisme gebruiken (Chatelin et al., 1996; Joliot
et al., 1997; Joliot et al., 1998; Prochiantz, 1999; Prochiantz, 2000).
De onconventionele secretie van homeoproteïnen
De onconventionele secretie en het intercellulair transport van homeoproteïnen werd
aangetoond via co-culturen van rat neuronen met Cos-7 cellen die het Engrailed
homeoproteïne tot expressie brengen. Engrailed wordt tot expressie gebracht en
gesecreteerd door de Cos-7 cellen en wordt vervolgens opgenomen in het cytosol en de
nucleus van de neuronen (Joliot et al., 1998; Prochiantz, 2000). De nucleaire export en
de secretie worden gereguleerd door de Δ1 sequentie, bestaande uit de C-terminus van
helix 2, de turn en de N-terminus van helix 3 van het Engrailed homeodomein (Maizel
et al., 1999). De Δ1 sequentie bevat een nucleaire export sequentie (NES, consensus
sequentie: 10-tal aminozuren rijk aan leucine en isoleucine) (Nakielny en Dreyfuss,
1999).
De onconventionele secretie verloopt niet via ‘klassieke’ secretory vesicles die van het
Golgi apparaat worden afgesnoerd, waardoor Engrailed niet wordt weerhouden in het
endoplasmatisch reticulum door co-translationele import. Engrailed associeert wel met
cholesterol- en glycosfingolipiderijke caveolae, wat suggereert dat secretie via
cholesterolrijke vesikels kan gebeuren, in analogie met Caveoline-1 (Joliot et al.,
1997).
19
De secretie van Engrailed wordt ook gereguleerd door proteïne kinase CK2
fosforylatie (Maizel et al., 2002). In dit kader is het opmerkelijk dat cholesterol efflux
uit cellen ook gereguleerd wordt door CK2 fosforylatie van de ABCA1 transporter
(Roosbeek et al., 2004). Bij de secretie van Engrailed spelen de celkern, het cellulair
cholesterol transport en fosforylatie door CK2 dus een actieve rol (Prochiantz en Joliot,
2003).
Andere proteïnen, zoals de Fibroblast Groeifactor FGF-1, het Tat proteïne (HIV
transactiveringsfactor) en het VP22 proteïne (een Herpes simplex1 capside proteïne)
ondergaan eveneens onconventionele secretie, opname en translocatie naar de nucleus
van dierlijke celculturen (Helland et al., 1991; Ensoli et al., 1993; Elliott en O'Hare,
1997).
Het onconventionele intercellulair transport werd echter alleen bij dierlijke cellen in
cultuur vastgesteld en niet bij levende metazoa. Dit kan te wijten zijn aan de uiterst
lage concentraties van de actieve proteïnen (Prochiantz en Joliot, 2003).
Het intercellulair uitwisselen van homeoproteïnen, zoals Knotted-1, werd wel
geobserveerd bij metaphyta (Lucas et al., 1995; Matsuoka en Bednarek, 1998).
Alhoewel de nucleaire export via associatie met mRNA en de intercellulaire
uitwisseling via plasmodesmata (buisvormige intercellulaire connecties) gebeurt, is er
wellicht homologie tussen onconventioneel intercellulair transport bij metazoa en
metaphyta (Prochiantz en Joliot, 2003; Joliot en Prochiantz, 2004).
Penetratin: een peptide dat correspondeert met de Antennapedia 3de
helix en op een endocytose-onafhankelijke manier wordt opgenomen
door cellen
Een gemuteerd Antp homeodomein met dubbele ΔW48ΔF49 deleties en een Q50S
substitutie in de derde helix, wordt niet meer geïnternaliseerd (Le Roux et al., 1993).
Dit suggereert de cruciale rol van de derde helix van het Antp homeodomein tijdens
het internaliseringsproces.
Het chemisch gesynthetiseerde Penetratin peptide, dat overeenkomt met residu’s 43
tot en met 58 van het Antp homeodomein, internaliseert zowel bij 37°C als bij 4°C ook
20
op een endocytose-onafhankelijke en concentratie-onafhankelijke manier (tussen 10
pM en 100 µM) en transloceert naar de celkern (Derossi et al., 1994; Prochiantz,
1999).
Om het endocytose-onafhankelijke internaliseringsmechanisme verder te bestuderen
werden verschillende Penetratin varianten ontworpen (Tabel 1).
Tabel 1. Overzicht van de aminozuursequenties van de derde helix van Antennapedia en van de
afgeleide peptiden en hun internalisering in cellen (Derossi et al., 1994; Derossi et al., 1996;
Prochiantz, 1996). De positief geladen aminozuurresidu’s zijn weergegeven in blauw, de
aromatische residu’s in groen.
Opname in
Peptide
Sequentie
cytosol
celkern
TERQIKIWFQNRRMKWKKWKKEN
TERQIKIWFQNRRMKXXXXXXXX
XXRQIKIWFQNRRMKWKKWKKEN
++
-
++
-
Penetratin (pAntp43-58) XXRQIKIWFQNRRMKWKKXXXXX
XXrqikiwfqnrrmkwkkXXXXX
D43-58
KKWKMRRNQFWIKIQR
58-43
++
++
++
++
++
++
Q50P
I45P, Q50P, K55P
XXRQIKIWFPNRRMKWKKXXXXX
XXRQPKIWFPNRRMPWKKXXXXX
+++
+
-
W48F, W56F
XXRQIKIFFQNRRMKFKKXXXXX
-
-
pAntp41-60
pAntp41-55
pAntp46-60
Zowel bij 37°C als bij 4°C, hebben een Penetratin variant die opgebouwd is uit Daminozuren (D43-58) en een retro-inverse variant (58-43), een opname-efficiëntie die
vergelijkbaar is met die van wild type Penetratin. De cellulaire internalisering van
Penetratin vereist dus geen interactie met een chirale receptor op het celoppervlak
(Derossi et al., 1996).
De opname van Penetratin varianten waarbij één (Q50P) of drie (I45P/Q50P/K55P)
aminozuren vervangen zijn door proline, een helixbrekend aminozuur, suggereert dat
de vorming van een α-helicale structuur niet noodzakelijk is voor de internalisering
van het peptide (Derossi et al., 1994).
Een Penetratin variant met een dubbele W48F/W56F substitutie wordt niet meer
geïnternaliseerd. Dit toont aan dat de internalisering niet alleen afhankelijk is van de
21
algemene hydrofobiciteit van het peptide, maar dat de tryptofaan residu’s een
specifieke rol spelen (Derossi et al., 1994).
Elektronenmicroscopie toonde aan dat Penetratin niet wordt opgenomen via coated
vesicles, waardoor ook aspecifieke opname via pinocytose wordt uitgesloten. Op basis
van deze resultaten suggereerden Derossi et al. dat Penetratin opgenomen wordt door
cellen via een directe interactie met de plasmamembraan, gevolgd door een translocatie
doorheen de lipidendubbellaag (Derossi et al., 1996).
De toepassingen van de Penetratin peptidevector
De endocytose-onafhankelijke internalisering van Penetratin wordt gebruikt om
hydrofiele cargomoleculen met een hoge efficiëntie binnen te brengen in cellen
(Prochiantz, 1996; Derossi et al., 1998a; Prochiantz, 1998; Lindgren et al., 2000). De
lijst van deze toepassingen is uitgebreid en hier worden enkel een paar voorbeelden
besproken.
Penetratin als vector voor de internalisering van peptiden
Om de verschillende functies binnen een multicellulair organisme te coördineren,
beschikken cellen over complexe mechanismen die berusten op proteïne-proteïne
interacties. Voor deze interacties bevatten proteïnen, naast hun functionele domein,
ook specifieke domeinen die betrokken zijn in de signalisatiecascaden. Om de functie
van een proteïne te bestuderen en te moduleren, worden inhibitor/antagonist peptiden
ontworpen die interageren met deze interactiedomeinen. Deze peptiden kunnen op een
efficiënte manier in cellen binnengebracht worden door koppeling aan de Penetratin
vector (Prochiantz, 1996; Derossi et al., 1998a; Dunican en Doherty, 2001).
Bij een eerste strategie wordt de peptidecargo chemisch gekoppeld aan Penetratin,
zodat een chimeer peptide gevormd wordt. Enerzijds worden de korte peptidecargo’s
chemisch in tandem met het Penetratin peptide gesynthetiseerd (Fig. 6-A). Anderzijds
kan Penetratin ook chemisch gesynthetiseerd worden met een nitro-pyridinium
geactiveerd cysteïne residu aan de N-terminus (Fig. 6-B). De nitro-pyridinium groep
22
voorkomt homodimerisatie van de Penetratin peptiden en vergemakkelijkt de vorming
van een disulfidebrug tussen een thiol bevattende cargo en de Penetratin vector. Bij
celopname wordt de cargo vrijgesteld door de reducerende omgeving van het cytosol,
waardoor verdere interferentie door Penetratin verhinderd wordt.
De cargopeptiden kunnen ook gemodificeerd worden. Gebiotinyleerde peptiden
kunnen bijvoorbeeld, samen met hun liganden, uit cellysaten geïsoleerd worden door
affiniteitschromatografie op een kolom waarop streptavidine gekoppeld is.
A
H2N-
RQIKIWFQNRRMKWKK
B
H2N-
CARGO
SH
CARGO
-COOH
CRQIKIWFQNRRMKWKK -COOH
|
S
|
S
N
O2N
H2N-
CARGO
CRQIKIWFQNRRMKWKK -COOH
|
S
|
S
+
H
HS
N
O2N
S
N
O2N
Figuur 6. Covalente koppeling van cargomoleculen aan de Penetratin vector. A, chemische synthese
in tandem; B, koppeling via disulfidebrug.
In een tweede strategie worden langere fusiepeptiden via recombinant technologie tot
expressie gebracht in E. coli. De chimere peptiden kunnen gemakkelijk gezuiverd
worden door de affiniteit van Penetratin voor heparine. Heparine binding kan ook
gebruikt worden om interagerende partners uit cellysaten te isoleren.
Om de veelzijdigheid van de Penetratin vector voor internalisering van peptidecargo’s
aan te tonen, wordt hier een korte opsomming gemaakt van enkele toepassingen.
23
De Penetratin vector werd succesvol gebruikt bij de studie van cellulaire
signalisatiecascaden betrokken bij de:
-
groei en differentiatie van neuronale cellen (bestuderen van Proteïne Kinase C
(PKC) (Theodore et al., 1995) en PRMT1 (predominant cellulair Arg Nmethyltransferase type 1) (Berthet et al., 2002)),
-
regulatie van de celcylcus (bestuderen van p16 en p21 inhibitie van Cdk’s
(Fahraeus et al., 1996; Mutoh et al., 1999; Kanovsky et al., 2003), p85
interactie met PI-3 kinase (Derossi et al., 1998b), de p53 tumorsupressor
(Mittelman en Gudkov, 1999), de SSeCKS tumorsupressor (Lin et al., 2000),
E2F transcriptiefactor interactie met Cdk (Chen et al., 1999)),
-
groeifactor gemedieerde signalisatie (bestuderen van Grb2 interactie met SOS,
MAPkinase fosforylatie (Cussac et al., 1999) en van Smad2 (Yakymovych et
al., 2002)),
-
glycolyse in het hart (bestuderen van Proteïne Kinase B(PKB) en 6-fosfofructo2-kinase (PFK2) (Pozuelo et al., 2003)),
-
adhesie en migratie van lymfocyten en tumorcellen (bestuderen van de CD44
transmembraanreceptor (Peck en Isacke, 1998) en ICAM1 (Greenwood et al.,
2003)),
-
apoptose (bestuderen van de p53 tumorsupressor (Mittelman en Gudkov, 1999;
Kanovsky et al., 2001; Li et al., 2002), E2F transcriptiefactor interactie met
Cdk (Chen et al., 1999), de eukaryote translatie initiatiefactor eiF4E (Herbert et
al., 2000), extralysosomaal cathepsineB (Schaschke et al., 2002), IAP
(Inhibitor of apoptosis proteins) interactie met Smac/DIABLO (Arnt et al.,
2002)),
-
vesikeltransport (bestuderen van SNAREs (Blair et al., 2001) en SNAPs
(Bennett et al., 2001)),
-
enz...
24
Penetratin als vector voor de internalisering van nucleïnezuren
Penetratin wordt ook gebruikt als vector voor het binnenbrengen van enkelstrengig
antisens oligonucleotiden die complementair zijn met het mRNA van een proteïne
waarvan men de expressie wil blokkeren. De antisens molecule verhindert de
translatie naar het proteïne door binding op het corresponderende mRNA. Voor deze
toepassing worden de antisens moleculen via een disulfidebrug gekoppeld aan de
Penetratin vector (Allinquant et al., 1995; Troy et al., 1996; Xu et al., 2003).
Een interessante toepassing is de internalisering van PNA met de Penetratin vector
(Prochiantz, 1998). PNA zijn synthetische, ongeladen antisens moleculen die bestaan
uit een achirale polyamide ruggengraat, gemodificeerd met nucleïnezuren. Hierdoor
zijn PNA resistent voor afbraak door proteasen en nucleasen. De binding van PNA
met zowel DNA als RNA is bovendien stabieler dan bij de natuurlijke homoduplexen,
waardoor PNA zowel de transcriptie als de translatie van het doelgen onderdrukken.
Disulfide en maleïmide gekoppelde PNA-Penetratin constructen worden gebruikt om,
zowel in vitro als in vivo, de expressie van doelgenen te onderdrukken (Pooga et al.,
1998c; Koppelhus et al., 2002). Braun et al. toonden recent aan dat enkel PenetratinS-S-NLS-PNA constructen PNA binnenbrengen in de celkern (Braun et al., 2002).
Penetratin als vector voor de internalisering van farmaceutica
Doxorubicine is een antitumoraal agens dat zich in het DNA intercaleert. De opname
van doxorubicine doorheen de bloed-hersen-barrière wordt verhoogd door de
koppeling aan een Penetratin variant die is opgebouwd uit D-aminozuren (Rousselle et
al., 2000). Door deze techniek kan multidrug resistentie omzeild worden (Mazel et al.,
2001).
De beperkingen van de Penetratin vector
De toepasbaarheid van de Penetratin vector is beperkt doordat de
membraantranslocatie niet moduleerbaar en aspecifiek is. Een Penetratin-cargo
construct wordt, zowel in vitro als in vivo, onmiddellijk opgenomen op de plaats waar
het geïnjecteerd werd. Er is vrijwel geen diffusie naar naburige cellen. Daarnaast
vertonen Penetratin en de andere CPP geen celspecificiteit. Dit kan een voordeel zijn
25
voor bepaalde toepassingen, maar wordt een probleem voor het in vivo adresseren van
farmaceutica in een specifiek orgaan of celtype (Joliot en Prochiantz, 2004).
Bovendien is ook de lengte van de cargo een beperking. Homeoproteïnen zijn de
langste peptidecargo’s waarvoor internalisering geobserveerd werd. Homeoproteïnen
kunnen immers beschouwd worden als natuurlijke fusieproteïnen van Penetratin
(Prochiantz, 1996). Synthetische peptidecargo’s van minder dan 100 aminozuren
worden normalerwijze zonder problemen geïnternaliseerd. Bij grotere fusieproteïnen
is de internalisering voornamelijk afhankelijk van de structuur van de cargo.
De internalisering van de Penetratin vector kan verder verhinderd worden door
interactie met zijn cargo. Dit is het geval voor dubbelstrengige oligonucleotiden die
langer zijn dan 55bp (bvb. expressievectoren). Hierdoor kan Penetratin niet gebruikt
worden voor DNA-transfecties (Prochiantz, 1996; Derossi et al., 1998a; Prochiantz,
1998). De interactie met DNA zou kunnen voorkomen worden door het DNA te
complexeren met een kationisch polymeer of in te kapselen in een liposoom of een
virus. Gratton et al. toonden recent aan dat Penetratin, zowel in vitro als in vivo, een
gunstige invloed heeft op de adenovirale transfectie van cellen (Gratton et al., 2003),
terwijl Tseng et al. aantoonden dat Penetratin additie de opname van liposomen met
doxorubicine verhoogt (Tseng et al., 2002). Penetratin kan dus ook als additionele
component gebruikt worden om de opname-efficiëntie te verhogen.
26
1.2.2. Andere celpenetrerende peptiden afgeleid van proteïne transductie
domeinen
Celpenetrerende peptiden afgeleid van HIV Tat
Het eerste CPP werd in 1988 door Green en Frankel ontdekt. Beide auteurs stelden
onafhankelijk van elkaar vast dat het HIV-1 Tat (Transactivator) proteïne via
membraantranslocatie in cellen kan internaliseren (Frankel en Pabo, 1988; Green en
Loewenstein, 1988).
Tat is een transcriptie activeringsfactor die betrokken is bij de replicatie van HIV. Het
Tat proteïne is, afhankelijk van de virale stam, 86 à 102 aminozuren lang en bestaat uit
drie functionele domeinen (Vogel et al., 1993; Lindgren et al., 2000). De negatief
geladen N-terminus is van belang voor de transactivatie, het cysteïnerijk DNA-bindend
domein heeft een zink-vinger motief en het C-terminale positief geladen domein bevat
de nucleaire lokalisatie sequentie (NLS) van het proteïne. Het Tat proteïne wordt, net
als homeoproteïnen, op een onconventionele manier intercellulair uitgewisseld.
Hierbij wordt het gesecreteerd en opgenomen in de celkern van naburige cellen
(Prochiantz, 2000).
Het Tat48-57 peptide is de minimale sequentie die nodig is voor membraantranslocatie
en opname in het cytosol en de celkern (Tabel 2) (Vives et al., 1997). Dit fragment
komt overeen met residu’s 48 tot 57 van het Tat proteïne en omvat het meest positief
geladen gebied en de nucleaire lokalisatie sequentie (NLS).
CPP afgeleid van het Tat proteïne worden zowel in vitro als in vivo gebruikt voor het
internaliseren van proteïnen (15 tot 120kDa), zelfs doorheen de bloed-hersen barrière
(Fawell et al., 1994; Vocero-Akbani et al., 1999; Schwarze et al., 1999; Schwarze et
al., 2000). Recent werden Tat peptiden ook gebruikt voor DNA-transfecties (Snyder
en Dowdy, 2001). Het positief geladen Tat47-57 peptide vormt door elektrostatische
interacties complexen met DNA. Deze complexen worden via endocytose opgenomen
en naar de celkern geadresseerd (Ignatovich et al., 2003; Rudolph et al., 2003).
Covalent gekoppelde Tat peptiden verhogen bovendien de transfectie-efficiëntie van
liposomen (Torchilin et al., 2003) en van faagsystemen (Eguchi et al., 2001; Nakanishi
et al., 2003). Tat wordt ook gebruikt om de internalisering van liposomen met
27
ingekapselde farmaceutica en van colloïdale partikels te verhogen (Lewin et al., 2000;
Torchilin et al., 2001; Tseng et al., 2002).
Het internaliseringsmechanisme van Tat CPP is afhankelijk van de experimentele
voorwaarden en van de gekoppelde cargo (Koppelhus et al., 2002; Suzuki et al., 2002;
Lundberg en Langel, 2003; Thoren et al., 2003; Vives, 2003). De initiële interactie
met de celmembraan is elektrostatisch, wat het belang van de arginine residu’s
verklaart (Ho et al., 2001; Ziegler et al., 2003). In het geval van endocytoseonafhankelijke opname, vermoedt men dat Tat rechtstreeks doorheen de
lipidendubbellaag transloceert. Hierdoor zijn de gekoppelde proteïnen gedeeltelijk
gedenatureerd na translocatie (Schwarze et al., 2000; Morris et al., 2001).
Celpenetrerende peptiden afgeleid van HSV VP22
Het VP22 proteïne is een structureel proteïne dat deel uitmaakt van het Herpes
Simplex Virus 1 (HSV-1) capside. De rol van dit proteïne gedurende de infectiecylus
van eukaryote cellen is nog onduidelijk. Het VP22 CPP komt overeen met het
proteïnetransductiedomein (PTD) van het VP22 proteïne (Tabel 2). Zowel het VP22
proteïne, als het VP22 CPP worden onafhankelijk van endocytose opgenomen in het
cytosol en de nucleus van cellen (Elliott en O'Hare, 1997). Het VP22 proteïne wordt
ook op een onconventionele manier intercellulair uitgewisseld (Prochiantz, 2000).
CPP afgeleid van VP22 worden gebruikt voor het internaliseren van proteïnen
(Schwarze et al., 2000; Stephens en Pepperkok, 2001).
28
1.2.3. Chimere celpenetrerende peptiden
Transportan
Transportan is een chimeer peptide van 27 aminozuren. Het bestaat uit de N-terminus
van Galanine, die via een C-terminaal lysine residu gekoppeld is met Mastoparan
(Tabel 2) (Soomets et al., 1997). Galanine is een sterk geconserveerd neuropeptide dat
bindt op de Galaninereceptor in het centraal zenuwstelsel en dat daardoor verschillende
biologische effecten bezit. Mastoparan is een membraandestabiliserend, amfifiel
peptide dat geïsoleerd werd uit bijengif.
De internalisering van Transportan is endocytose- en celtype-onafhankelijk (Pooga et
al., 1998a en b). Transportan werd zowel in vitro en in vivo succesvol gebruikt om
antisens PNA te internaliseren (Pooga et al., 1998c). De belangrijkste nadelen aan de
Transportan vector zijn de lengte van de vector en de inhibitie van GTPase activiteit.
De PT10 Transportan deletievariant (AGYLLGKINLKALAALAKKIL) wordt niet
alleen geïnternaliseerd in eukaryote cellen, maar doodt ook prokaryote cellen door
membraanpermeabilisatie (Nekhotiaeva et al., 2003).
Tabel 2. Aminozuursequenties van celpenetrerende peptiden (CPP). De positief geladen residu’s zijn
weergegeven in blauw, de aromatische residu’s in groen.
Naam van het CPP
Sequentie
CPP afgeleid van PTD
Penetratin (pAntp43-58)
Tat48-57
VP22
RQIKIWFQNRRMKWKK
GRKKRRQRRR
NAATATRGRSAASRPTERPRAPARSASRPRRPVE
Chimere CPP
Transportan
KLA Modelpeptide I
LAH-4
SN50
MPG
Pep-1
Pep-2
GWTLNSAGYLLGKINLKALAALAKKIL
KLALKLALKALKAALKLA
KKALLALALHHLAHLALALHLALALKKA
AAVALLPAVLLALLAPVQRKRQKLM
GALFLGFLGAAGSTMGAWSQPKSKRKV
KETWWETWWTEWSQPKKKRKV
KETWFETWFTEWSQPKKKRKV
29
KLA Modelpeptide I en afgeleiden
Het KLA Modelpeptide I is een canoniek, amfipatisch peptide (Tabel 2). Het wordt
zowel bij 37°C als bij 4°C in vitro geïnternaliseerd in het cytosol en de nucleus van
cellen, met een efficiëntie die vergelijkbaar is met die van Penetratin (Oehlke et al.,
1998).
Het internaliseringsmechanisme werd bestudeerd door de synthese van varianten van
het KLA Modelpeptide I.
Dit toonde aan dat de internalisering minimum 16
aminozuren en een netto-positieve lading van het peptide vereist. De amfipaticiteit van
het peptide is echter niet noodzakelijk (Scheller et al., 1999; Scheller et al., 2000).
De celpenetrerende Modelpeptiden werden gebruikt voor het binnenbrengen van
peptiden (gekoppeld via een disulfidebrug) en van oligonucleotiden. Oligonucleotiden
die een niet-covalent complex vormen met de Modelpeptiden, worden met een hogere
efficiëntie geïnternaliseerd dan hun covalent gekoppelde tegenhangers (Oehlke et al.,
2002).
Kichler et al. gebruikten het LAH4 peptide, een histidine bevattende variant van het
KLA Modelpeptide I, om cellen met een hoge efficiëntie te transfecteren (Kichler et
al., 2003). Dit peptide vormt elektrolietcomplexen met het DNA die via endocytose
worden opgenomen. Men vermoedt dat de histidine residu’s bij variërende pH een rol
spelen bij de heroriëntatie van het peptide in lipidendubbellagen. Dit kan van belang
zijn bij het ontsnappen van de LAH-4/DNA complexen uit de endosomen.
MTS-NLS peptiden
Deze chimere peptiden bestaan uit een relatief hydrofobe MTS (Eng. membrane
translocating sequence), gekoppeld aan een NLS (nucleaire lokalisatie sequentie)
(Hawiger, 1999). De MTS, ook signaalsequentie genoemd, is verantwoordelijk voor
de co-translationele import van een pre-proteïne in celorganellen (bvb.
endoplasmatisch reticulum of mitochondria). De NLS is verantwoordelijk voor de
import van proteïnen in de kern. MTS-NLS peptiden worden onafhankelijk van
receptor of caveolae gemedieerde endocytose opgenomen.
30
Lin et al. gebruikten SN50 chimere peptiden, bestaande uit de MTS K-FGF MTS die
gekoppeld is aan de NLS van NF-KB, om TNF-α of lipopolysaccharide (LPS)
geïnduceerde inflammatoire respons van NIH-3T3 cellen te onderdrukken. Het
celpenetrerende construct fungeert als competitieve inhibitor voor nucleaire import van
endogeen NF-KB via de nucleaire translocatie machinerie (Lin et al., 1995). Dit
construct wordt enkel bij 37°C geïnternaliseerd. De internalisering is bovendien
concentratie-afhankelijk.
Morris et al. gebruikten MPG chimere peptiden, bestaande uit de MTS van HIV gp41
en de NLS van het SV40 T-antigen, om enkelstrengige en dubbelstrengige
oligonucleotiden (o.a. plasmide DNA) te internaliseren. De MPG peptiden vormen
niet-covalente elektrolietcomplexen met DNA, die zowel bij 37°C als bij 4°C in de
celkern worden opgenomen (Morris et al., 1997; Morris et al., 1999; Morris et al.,
2000). De Pep-1 variant is in staat om volledige proteïnen te internaliseren via nietcovalente complexvorming (Morris et al., 2001). De Pep-2 variant werd gebruikt voor
de internalisering van HypNA-PNA chimere antisens moleculen. HypNA-PNA
bestaan uit PNA-dimeren, die afgewisseld zijn met geladen trans-4-hydroxyl-L-proline
(HypNA) monomeren.
De negatieve lading van HypNA-PNA maakt de
complexvorming met de vector eenvoudiger (Morris et al., 2004).
31
1.2.4. De studie van de lipideninteracties van peptiden
Ondanks het feit dat de lijst van CPP regelmatig uitbreidt, blijft het
internaliseringsmechanisme van CPP nog onduidelijk (Prochiantz, 1999; Lindgren et
al., 2000; Prochiantz, 2000; Schwarze et al., 2000). Rekening houdend met de
fysicochemische diversiteit en de verschillende toepassingen van CPP, is het mogelijk
dat verschillende internaliseringsmechanismen bestaan (Lundberg en Langel, 2003).
Derossi et al. suggereerden dat Penetratin peptiden door een directe interactie met de
celmembraan worden opgenomen (Derossi et al., 1996). Dit zou impliceren dat het
peptide de celmembraan doorkruist en daarbij de lipidendubbellaag (partieel)
destabiliseert.
Om deze hypothese te onderzoeken is het noodzakelijk om de
interacties van het Penetratin peptide met lipidendubbellagen te bestuderen.
Hieronder wordt een overzicht gegeven van de gekende mechanismen waarmee
peptiden membranen destabiliseren.
Vervolgens wordt het hypothetisch
membraantranslocatiemodel van Prochiantz et al. besproken (Prochiantz, 1996).
De hydrofobe kern van oplosbare proteïnen
Peptiden die deel uitmaken van de hydrofobe kern van oplosbare proteïnen, worden
van een waterige naar een hydrofobe omgeving getransfereerd. Deze transfer wordt
bepaald door het entropisch gedreven hydrofoob effect waarbij hydrofobe
componenten worden uitgestoten door water en zich groeperen (White et al., 2001).
De gemiddelde hydrofobiciteit <H0> van een peptide is een maat voor de intrinsieke
mogelijkheid van het peptide om over te gaan van water naar een hydrofobe fase.
<H0> is het gemiddelde van de hydrofobiciteit per aminozuur, die wordt uitgedrukt
volgens verschillende hydrofobiciteitsschalen. Een courant gebruikte schaal is de
consensusschaal van Eisenberg, die werd opgesteld bij het bestuderen van de
opvouwing van proteïnen (Eisenberg et al., 1984). De consensusschaal geeft voor elk
aminozuur een gemiddelde van verscheidene experimentele en theoretische waarden.
32
Omwille van het hydrofobe karakter van de lipidendubbellaag, kan de opvouwing van
lipidenbindende peptiden of van transmembraanproteïnen niet verklaard worden door
het hydrofoob effect alleen.
De ‘niet klassieke’ hydrofobe omgeving van lipidendubbellagen
De lipidendubbellaag is een complex milieu dat twee regio’s bevat (Fig. 7). Het waterlipiden grensvlak omvat de regio van de fosfolipidehoofdgroepen, de glycerol
ruggengraat, de carbonyl van de veresterde vetzuren en bevat water. De hydrofobe
kern van de membraan omvat de acylketens. De doorsnede van een lipidendubbellaag
(grensvlak - hydrofobe kern - grensvlak) wordt gemiddeld geschat op 4.5 à 5 nm
(White et al., 2001).
Door de complexiteit van lipidendubbellagen, spelen naast de hydrofobiciteit van de
molecule, ook de structuur, de aanwezigheid van zijgroepen of vertakkingen, enz. een
belangrijke rol bij water-lipide transfer. Daardoor wordt de transfer van moleculen
vanuit water naar een lipidendubbellaag voornamelijk gedreven door
enthalpieveranderingen. Dit wordt beschouwd als het ‘niet-klassiek hydrofoob effect’
of het ‘dubbellaag effect’ (Seelig en Ganz, 1991).
Wimley en White ontwikkelden een hydrofobiciteitsschaal voor de transfer van
aminozuren van water naar het grensvlak van de lipidendubbellaag, rekening houdend
met het dubbellaag effect (Wimley en White, 1996; White en Wimley, 1999). Deze
schaal komt grosso modo overeen met de consensusschaal van Eisenberg, met
uitzondering van tryptofaan. De overgang van tryptofaan van water naar het grensvlak
van de lipidendubbellaag is energetisch gunstig. De vrije energie voor de transfer van
tryptofaan naar een water-POPC grensvlak (-1.85 kcal/mol) is zelfs drie maal groter
dan de tranfer van leucine (-0.56 kcal/mol) (White en Wimley, 1999). De preferentiële
lokalisatie van tryptofaan aan het water-lipiden grensvlak wordt toegeschreven aan een
perfecte balans tussen enerzijds het hydrofoob effect, waardoor tryptofaan wordt
uitgestoten door water, en anderzijds de elektrostatische interacties tussen de
aromatische indolring en de gehydrateerde lipidehoofdgroepen (Yau et al., 1998). De
aanwezigheid van aromatische residu’s, en in het bijzonder tryptofaan, wordt daarom
33
beschouwd als een gunstige factor voor peptide-lipide interacties. Hiermee rekening
houdend, kan de consensusschaal van Eisenberg toch gebruikt worden voor het
bestuderen van peptide-lipide interacties (Dathe en Wieprecht, 1999).
De interacties van peptiden met lipidendubbellagen
De insertie van peptiden in lipidendubbellagen werd door White en Wimley verklaard
op basis van de thermodynamische principes en van het dubbellaag effect (Wimley en
White, 1996 en 1999; White et al., 2001).
De interactie van peptiden met
lipidendubbellagen is te wijten aan de delicate balans tussen elektrostatische interacties
en het hydrofoob effect (Fig. 7) (Dathe et al., 1997).
Figuur 7. Schematische voorstelling van de insertie van peptiden in lipidendubbellagen (White et al.,
2001). De figuur is gebaseerd op het 4-staps thermodynamische model van Wimley en White
voor de binding (1), opvouwing (2), insertie (3) en aggregatie (4) van α - h e l i c a l e
membraaninteragerende peptiden.
De initiële binding van het peptide met het water-lipiden grensvlak van de membraan,
wordt gedreven door elektrostatische interacties tussen positief geladen
aminozuurresidu’s van het peptide en negatief geladen fosfolipidehoofdgroepen in de
membraan.
34
Vervolgens treedt insertie van de peptiden in het water-lipiden grensvlak op. De
water-lipide transfer van de hydrofiele peptidebinding (NH-CO) is energetisch
ongunstig. De vrije energie voor de water-lipide transfer van de peptidebinding is
vergelijkbaar met die van de transfer van een geladen aminozuur. Dit wordt echter
gecompenseerd door de vorming van intramoleculaire waterstofbruggen, waardoor de
insertie van peptiden in de lipidendubbellaag gepaard gaat met de inductie van de
secundaire structuur (opvouwing). Daarnaast spelen ook andere factoren een rol bij de
insertie van peptiden in membranen, zoals de aanwezigheid van aromatische residu’s
(cf. supra) en de interacties van de aminozuurzijketens onderling (Eng. side chain
packing) en met de membraan.
Tenslotte kan ook aggregatie van de peptiden in de lipidendubbellaag optreden.
Tijdens de opvouwing van membraanproteïnen wordt de clustering van de hydrofobe
transmembraanhelices voornamelijk gedreven door van der Waals interacties. Deze
interacties zijn immers groter voor peptide-peptide interacties dan voor peptide-lipide
interacties. Daarnaast is de oriëntatie van de lipidenacylketens rond de relatief rigide
helices entropisch ongustig.
Volgens het model van White en Wimley zijn
waterstofbruggen van ondergeschikt belang bij de aggregatie van de
transmembraanhelices.
De transitie van α-helicale peptiden naar een geaggregeerde β-sheet wordt daarentegen
wel gedreven door de vorming van waterstofbruggen. Deze α−β transitie wordt door
White en Wimley dan ook beschouwd als de vorming van de meest gunstige
secundaire structuur (cf. supra) (White en Wimley, 1999).
Het belang van amfipaticiteit bij de insertie van peptiden in membranen
Amfipatische peptiden hebben een structuur waarbij de hydrofobe en geladen
aminozuurresidu’s ruimtelijk gegroepeerd zijn in discrete sectoren. De amfipaticiteit
van lipidenbindende peptiden komt tot uiting wanneer ze hun secundaire structuur
aannemen ten gevolge van insertie in de lipidendubbellaag.
De amfipaticiteit
35
beïnvloedt vervolgens de insertiediepte van het peptide in de membraan en de daarbij
horende destabilisatie van de lipidendubbellaag (White en Wimley, 1999).
Figuur 8. De verschillende oriëntaties waarmee amfipatische peptiden associëren met lipiden (Groen
staat voor hydrofiel, grijs voor hydrofoob) (Brasseur et al., 1997). A, volledig hydrofobe peptiden
vormen transmembranaire verankeringsegmenten; B, predominant hydrofobe peptiden vormen
transmembraankanalen; C, peptiden die half-hydrofiel en half-hydrofoob zijn, associëren met het
water-lipiden grensvlak; D, predominant hydrofiele peptiden omhullen de lipidendubbellaag; E,
peptiden met een hydrofobe gradiënt langs hun lengteas penetreren slechts gedeeltelijk en schuin
georiënteerd in de lipidendubbellaag.
36
De amfipatische α-helix is een motief dat een optimale interactie van peptiden en
proteïnen met de amfifiele structuur van biologische membranen toelaat (Dathe et al.,
1996; Wieprecht et al., 1997a en b; Dathe en Wieprecht, 1999; Dathe et al., 2002). Het
helicaal hydrofoob moment <µH> is een kwantitatieve maat voor de amfipaticiteit van
α-helicale peptiden en wordt gedefinieerd als de vectorsom van de hydrofobiciteiten
van de individuele aminozuren in het peptide (Eisenberg et al., 1984).
Door Brasseur et al. werden membraaninteragerende peptiden onderverdeeld in vijf
klassen, afhankelijk van de hydrofobe hoek en de hydrofobe gradiënt langs de lengteas
van de peptiden (Fig. 8) (Brasseur et al., 1997).
De permeabilisatie van membranen door peptiden
Bij membraanpermeabilisatie gaat de integriteit van de membraan verloren, waardoor
water doorheen de lipidendubbellaag lekt (Dathe en Wieprecht, 1999).
Anti-microbiële peptiden zijn amfipatische α-helicale peptiden die micro-organismen
doden door binding op het celoppervlak, gevolgd door membraanpermeabilisatie. De
studie van de lipideninteractie van deze peptiden, leidde tot de karakterisatie van drie
mechanismen voor membraanpermeabilisatie (Fig. 9).
Barrel stave poriën (poriën in de vorm van een duigenton) bestaan uit bundels van
amfipatische α-helicale peptiden, die loodrecht op het vlak van de membraan
georiënteerd zijn (Fig. 9-A). De hydrofobe zijden van de peptiden maken hierbij
contact met de hydrofobe kern van de membraan, terwijl de hydrofiele zijden naar
elkaar wijzen. Hierdoor wordt een hydrofiele transmembraanopening gevormd, waar
water en opgeloste moleculen doorheen diffunderen (Shai, 1999). Het antibacteriële
Melittin peptide (uit bijengif) destabiliseert membranen volgens dit mechanisme
(Matsuzaki et al., 1997; Yang et al., 2001).
37
Figuur 9. De gekende mechanismen waarmee peptiden membranen permeabiliseren. A, barrel stave
porie; B, toroid porie (zgn. worm hole); C, detergent model.
Toroid poriën, ook worm holes genoemd, zijn dynamische peptide-lipide
macromoleculaire structuren (Fig. 9-B) (Matsuzaki, 1999). De peptiden accumuleren
zich parallel met het vlak op de membraan. Door lipidenbinding nemen de peptiden
een amfipatische α-helix structuur aan, gevolgd door een reoriëntatie, waardoor ze met
hun hydrofobe zijde naar de kern van de membraan gericht worden. Dit veroorzaakt
38
een lokale verdunning en positieve curvatuur van de lipidendubbellaag (cf. Fig. 2).
Tenslotte ontstaat een kortstondige porie waarbij de peptiden in contact blijven met de
hoofdgroep van de fosfolipiden.
Door deze transiënte opening gebeurt
transmembraantransport van wateroplosbare moleculen. Tegelijkertijd transloceren
ook peptiden en lipiden (lipide flip-flop) van de ene naar de andere zijde van de
membraan. Het antibacteriële Magainin peptide (uit de huid van Xenopus laevis
kikkers) gebruikt dit mechanisme voor destabilisatie van bacteriële membranen
(Ludtke et al., 1995 en 1996; Wieprecht et al., 1996; Schumann et al., 1997).
In het detergent model wordt het water-lipiden grensvlak van de membraan bedekt met
peptiden (Fig. 9-C). De peptiden dringen niet binnen in de hydrofobe kern van de
lipidendubbellaag. Bij het overschrijden van een drempelconcentratie loopt de
spanning aan het water-lipiden grensvlak zo hoog op dat de lipidendubbellaag lokaal
desintegreert (Maher en Singer, 1984). De antibacteriële peptiden Gramicidine (uit
Bacillus brevis) en Cecropine (uit het hemolymfe van de zijdemot) werken volgens dit
mechanisme (Katsu et al., 1989; Gazit et al., 1995). Het dient opgemerkt dat de αhelicale structuur van de peptiden niet noodzakelijk is om membranen te destabiliseren
door dit mechanisme (Shai, 1999).
De fusie van membranen door schuin georiënteerde fusogene peptiden
In de cel versmelten vesikels voortdurend met elkaar, met de celmembraan en met
intracellulaire compartimenten.
Membraanfusie, het verschijnsel waarbij
lipidendubbellagen met elkaar versmelten om opnieuw een intacte dubbellaag te
vormen, is dan ook cruciaal voor levende cellen.
Membraanfusie werd uitvoerig bestudeerd op modelmembranen (vesikels). Doordat
het een transiënt proces is, werd het fusiemechanisme echter nog niet volledig
opgehelderd. De lipidendubbellagen maken eerst contact met elkaar doordat de
liposomen aggregeren (Fig. 10) (Wilschut en Hoekstra, 1986; Kozlovsky en Kozlov,
2002; Lentz et al., 2002; Markin en Albanesi, 2002). Vervolgens worden beide
39
membranen gedestabiliseerd en vermengen de lipiden zich.
Tijdens deze
transitietoestand zijn de lipiden georganiseerd als omgekeerde micel of als steel tussen
de liposomen. Hierbij wordt de hexagonale HII fase gevormd. Tenslotte versmelten
de membranen volledig, waardoor de waterige inhoud van beide liposomen zich
vermengt.
Figuur 10. Schematische voorstelling van de gekende modellen voor membraanfusie. Tijdens de
transitietoestand (midden) wordt de hexagonale HII fase gevormd, waarbij de lipiden als
omgekeerde micel of als steel georganiseerd zijn.
Fusie van membranen wordt bevorderd door de aanwezigheid van fosfolipiden die bij
voorkeur als omgekeerde micel georganiseerd zijn, zoals fosfatidylethanolamine (PE)
en fosfatidinezuur (PA) (cf. supra).
Ook fusogene peptiden katalyseren
membraanfusie (Epand, 2003). Deze amfipatische peptiden nemen bij lipidenbinding
meestal een α-helicale conformatie aan. Bepaalde virale fusogene peptiden nemen bij
lipidenbinding echter een β-structuur aan. Fusogene peptiden dringen met hun
hydrofoob gedeelte in de lipidendubbellaag binnen en zijn daardoor schuin
40
georiënteerd in de lipidendubbellaag (45° - 50°) (Fig. 8-E) (Brasseur et al., 1997;
Decout et al., 1998 en 1999). Na oligomerisatie induceren deze peptiden een negatieve
membraancurvatuur en verlagen ze de spanningsdrempel voor het verbreken van de
membraanintegriteit. Bijgevolg gaat fusie van lipidendubbellagen gepaard met het
lekken van de waterige inhoud van de vesikels.
Fusogene peptiden komen voor bij lipolytische enzymen en bij virussen met een
lipidenmantel (proteïne HA bij influenza, glycoproteïne gp41 bij HIV, glycoproteïne
gp31 bij SIV) (Brasseur et al., 1997; Martin et al., 1999; Lau et al., 2004; Li et al.,
2003). De virale peptiden katalyseren de versmelting van de virale lipidenmantel met
cellulaire membranen tijdens de internalisering.
Het Aβ peptide, de belangrijkste component van extracellulaire plaques in de hersenen
van Alzheimer patiënten, heeft ook fusogene eigenschappen (Pillot et al., 1996). Aβ
peptiden nemen bij lipidenbinding een α-helicale structuur aan en zijn schuin
georiënteerd in de membraan. Door aggregatie tot β-structuren worden de peptiden
membraandestabiliserend en neurotoxisch (Terzi et al., 1997). Neurotoxische Prion
peptiden vertonen ook dit structurele kameleon karakter en induceren membraanfusie
(Pillot et al., 1997).
Via hun fusogene segmenten, katalyseren SNARE proteïnen de docking en het
versmelten van intracellulaire vesikels (Schuette et al., 2004).
41
De membraantranslocatie van Penetratin
Op basis van de endocytose-onafhankelijke internalisering van Penetratin in cellen,
suggereerden Derossi et al. dat het peptide opgenomen wordt door
membraantranslocatie doorheen de lipidendubbellaag van de plasmamembraan (cf.
1.2.1.) (Derossi et al., 1996). Bij dit proces zouden de tryptofaan residu’s (Trp48 en
Trp56) een cruciale rol spelen, terwijl de algemene hydrofobiciteit, het α-helicale
karakter en de amfipaticiteit van het peptide minder van belang zijn (Derossi et al.,
1994 en 1996).
De vergelijking van de aminozuursequenties toont aan dat alle CPP rijk zijn aan
arginine residu's, wat de interacties van peptiden met negatief geladen componenten
aan het celoppervlak mogelijk maakt (Schwarze et al., 2000).
De positieve lading van Penetratin (pI = 12.3) verklaart dan ook de interactie met
negatief geladen SDS micellen en met negatief geladen SUV, bestaande uit
zwitterionische fosfatidylcholine (PC) en negatief geladen fosfatidylserine (PS). Deze
interacties werden door Berlose et al. bestudeerd (Berlose et al., 1996). Via circulair
dichroisme en 1H-NMR spectroscopie werd aangetoond dat Penetratin een random
structuur heeft in water en dat de α-helicale conformatie wordt geïnduceerd in
organische solventen en in aanwezigheid van SDS micellen.
31
P-NMR bevestigde de
interactie van Penetratin met SUV bestaande uit fosfatidylcholine (PC) en
fosfatidylserine (PS), alhoewel geen vesikelfusie werd waargenomen. Het peptide
destabiliseert echter wel fosfatidylcholine/fosfatidylethanolamine (PC/PE) SUV en
induceert de vorming van omgekeerde micellen (hexagonale HII fase) bij MLV van
een ruw lipidenextract uit rattenhersenen (Berlose et al., 1996).
De dubbele
W48F/W56F variant, die niet geïnternaliseerd wordt door cellen, induceert geen
omgekeerde micellen (Prochiantz, 1996). Dit duidt het belang van de tryptofaan
residu’s bij de lipideninteractie aan.
Deze fysicochemische data bevestigen de Penetratin-lipideninteractie hypothese van
Derossi et al.
( D e r o s s i et al., 1996) en vormen de basis van het
membraantranslocatiemodel voorgesteld door Prochiantz (Fig. 11) (Prochiantz, 1996;
Derossi et al., 1998a; Prochiantz, 1999).
42
Figuur 11. Model voor membraantranslocatie van Penetratin, zoals voorgesteld door Prochiantz et
al. (Prochiantz, 1996).
43
De eerste stap in dit hypothetische translocatiemodel bestaat uit elektrostatische
interacties tussen de positief geladen aminozuurresidu’s van het Penetratin peptide en
negatief geladen lipiden in de buitenste zijde van de celmembraan. Hierbij groeperen
de negatief geladen lipiden zich rond het peptide.
Vervolgens wordt de lipidendubbellaag gedestabiliseerd door de tryptofaan residu’s
van het peptide. Hierdoor wordt de curvatuur van de membraan vervormd en worden
omgekeerde micellen (hexagonale HII fase) geïnduceerd. De omgekeerde micellen
vormen een hydrofiele holte in de membraan, die het Penetratin peptide, samen met de
daaraan gekoppelde hydrofiele cargo, in het waterig medium bevat. De omgekeerde
micellen versmelten tenslotte met de cytoplasmatische lipidenlaag van de
celmembraan, waardoor het peptide kan vrijgesteld worden in het cytosol.
Dit hypothetische model kan de opname van kleine hydrofiele cargo’s (peptiden,
oligonucleotiden, PNA, ..) verklaren. Het peptide blijft, samen met zijn gekoppelde
cargo, voortdurend in contact met zowel het waterige milieu als met de lipiden. Dit
model wordt echter in vraag gesteld door de cellulaire internalisering van volledige
homeoproteïnen, de grootste gekende cargo’s. Het is immers onwaarschijnlijk dat
proteïnen van enkele kDa vervat kunnen worden in een omgekeerde micel.
44
1.3. Polymeervectoren voor DNA-transfecties
Polymeervectoren zijn synthetische, wateroplosbare, structurele componenten die de
cellulaire internalisering van farmaceutica, proteïnen of transgenen vergemakkelijken
door complexvorming of koppeling met de cargo (Lukaszczyk en Schacht, 1992;
Duncan, 2003). Hierdoor kunnen de concentratie en de frequentie van toediening van
de farmaceutica verminderd worden, om neveneffecten bij patiënten te voorkomen.
Zelf-assemblerende blok-copolymeer micellen worden bijvoorbeeld gebruikt voor de
efficiënte internalisering van doxorubicine, zodat P-glycoproteïne multidrug resistentie
kan omzeild worden (Batrakova et al., 1996). Het conjugeren van systemisch
toegediende therapeutische proteïnen met polyethyleenglycol (PEG) wordt gebruikt
om de oplosbaarheid en de stabiliteit te verhogen en om de immunogeniciteit en
urineklaring te verminderen (Harris en Chess, 2003).
Met het oog op gentherapie, werden polymeervectoren ontwikkeld om DNA binnen te
brengen in cellen. In §1.1.3. werd al vermeld dat de spontane opname van transgenen
door eukaryote cellen wordt verhinderd door de negatieve lading en het grote
hydrodynamische volume van het DNA en door afbraak door nucleasen (Bally et al.,
1999; Garnett, 1999). Om deze problemen te vermijden worden polynucleotiden
gecombineerd met transfectievectoren. De ideale tranfectievector condenseert het
DNA, waardoor het volume verkleint. Het DNA wordt ook beschermd tegen afbraak
door nucleasen. Daarnaast internaliseert de transfectievector het DNA in het cytosol
en de nucleus van de cel. In de nucleus kan het transgen dan overgeschreven
(transcriptie) worden om tenslotte vertaald (translatie) te worden naar het gewenste
proteïne (Bally et al., 1999).
Virussen zijn totnogtoe de meest efficiënte transfectievectoren (cf. 1.1.3.).
De
klinische toepassingen blijven echter beperkt door de inflammatoire respons die ze
opwekken, door immunogeniciteit bij herhaaldelijke behandelingen, door de lange
termijn risico’s die ze inhouden en door de beperkte lengte van de transgenen (Garnett,
1999). Virussen zijn bovendien niet celspecifiek (Sparrow et al., 1998).
45
Een alternatief zijn de synthetische, niet-virale vectoren: kationische liposomen en
polymeren. De synthetische vectoren bieden verschillende voordelen ten opzichte van
virale vectoren. Over het algemeen zijn synthetische vectoren veiliger voor in vivo
toepassingen (Schmidt-Wolf en Schmidt-Wolf, 2003). Daarnaast is de lengte van het
transgen onbeperkt en zijn synthetische vectoren gemakkelijker en goedkoper te
produceren (Lollo et al., 2000). De klinische toepassing van lipofectie (transfectie
door middel van synthetische kationische liposomen, cf. 1.1.3.) wordt verhinderd door
toxische neveneffecten en door ongewenste interacties van de lipoplexen met
serumproteïnen (Behr, 1994; Schmidt-Wolf en Schmidt-Wolf, 2003).
Een alternatief zijn de kationische transfectiepolymeren (Garnett, 1999; De Smedt et
al., 2000). Het gebruik van kationische polymeren voor transfectie is voortgevloeid uit
studies van de positief geladen arginine- en lysinerijke Histon proteïnen, die in de
celkern het DNA condenseren tot chromosomen. Di-ethyl-amino-ethyl dextraan en
poly-L-Lysine (PLL) waren de eerste polyamines die gebruikt werden voor polyfectie
(transfectie door middel van synthetische kationische polymeren). Hun transfectieefficiëntie is echter aanzienlijk lager dan die van de virale vectoren.
46
1.3.1. Polyethyleenimine: de protonenspons die cellen transfecteert
Polyethyleenimine (PEI) is een kationisch, lineair of vertakt polymeer dat een
uitgebreid toepassingsgebied kent, gaande van de papierindustrie, over waterzuivering,
tot de productie van cosmetica.
Vertakt PEI is tot op heden één van de meest efficiënte en best bestudeerde
transfectiepolymeren (Boussif et al., 1995) en wordt daardoor in vele polyfectiestudies
als referentie gebruikt (Duncan, 2003). De ruggengraatstructuur van PEI bevat talrijke
aminefunties en heeft één stikstof per twee koolstofatomen (Fig. 13-A). De hoge
transfectie-efficiëntie van PEI wordt verklaard door de protonering van deze
aminogroepen, waardoor PEI een groot pH-gebied buffert (Godbey et al., 1999a).
Hieronder wordt het concept van polyfectie uitgelegd aan de hand van PEI (Fig. 12).
In een fysiologische buffer (pH = 7.4) komt PEI voor als polykation doordat een
gedeelte van de aminefunties geprotoneerd is. Door elektrostatische interacties met de
negatieve ladingen van de polynucleotiden, vormt PEI spontaan inter-polyelektrolietcomplexen (IPEC) met DNA. Dit resulteert in de condensatie (20 à 150 nm)
door neutralisatie van de negatieve ladingen van het DNA (Dunlap et al., 1997) en de
bescherming tegen afbraak door nucleasen (Godbey et al., 2000). De vorming van
IPEC (of polyplexen) is efficiënter door vertakt dan door lineair PEI. De efficiëntie
neemt ook toe bij stijgende ladingsverhouding (dit is de verhouding van het aantal
positieve ladingen van het polymeer over het aantal negatieve ladingen van het DNA)
(Minagawa et al., 1991; Felgner et al., 1997).
De PEI-DNA complexen hebben een netto positieve lading, waardoor ze met het
negatief geladen celoppervlak van eukaryote cellen interageren en aggregeren (Godbey
et al., 2000). Deze aggregaten worden via aspecifieke endocytose opgenomen door de
cellen (Godbey et al., 1999b; Godbey en Mikos, 2001; Remy-Kristensen et al., 2001).
Partikels die via endocytose opgenomen werden, komen normalerwijze in de
lysosomen terecht, waar ze gehydrolyseerd worden (cf. 1.1.2.). Dit verklaart waarom
additie van chloroquine een gunstige invloed heeft op polyfecties (Ogris et al., 1998).
47
Figuur 12. Schematische voorstelling van het transfectieproces van PEI-DNA polyplexen. A, DNAcondensatie; B, interactie met het celoppervlak; C, endocytose van de polyplexen; D, zwellen van
de endosomen door protoneninflux; E, openbarsten van de endolysosomen met vrijstelling van de
polyplexen in het cytosol, gevolgd door nucleaire translocatie; F, transcriptie en G, translatie van
het transgen naar het proteïne.
De hoge transfectie-efficiëntie van PEI wordt echter toegeschreven aan het feit dat
PEI-DNA complexen uit endolysosomen kunnen ontsnappen en hierdoor hydrolyse
voorkomen. Volgens de protonenspons theorie van Behr, is dit te wijten aan de
bufferende eigenschappen van PEI (Behr, 1997). Door de import van protonen
verzuren de endosomen (cf. 1.1.2.), waardoor de aminogroepen van PEI verder
geprotoneerd worden. Deze endolysosomale pH buffering katalyseert de influx van
protonen en chloride tegenionen, wat een osmotisch effect creëert. Hierdoor zwellen
de endolysosomen en barsten ze open, waarbij de PEI-DNA complexen vrijgesteld
worden in het cytosol. Het ontsnappen uit de endolysosomen zou verder gekatalyseerd
worden door het zwellen van de PEI-DNA complexen bij lage pH en door
48
permeabilisatie van lysosomale membranen door PEI (Klemm et al., 1998). De
buffering van de endolysosomale pH inactiveert ook de lysosomale enzymen (Godbey
et al., 1999b).
Omdat de PEI-DNA complexen ook naar de celkern transloceren, kunnen ook niet
delende cellen getransfecteerd worden. Er is momenteel echter geen consensus over
de nucleaire translocatie van PEI en het mechanisme voor nucleaire import is nog niet
opgehelderd (Godbey et al., 1999a, 1999b en 2000; Remy-Kristensen et al., 2001;
Bieber et al., 2002; Dubruel et al., 2004).
De transfectie van cellen door PEI-DNA polyplexen heeft zowel voor- als nadelen.
Zoals andere synthetische kationische polymeren, kan PEI gebruikt worden voor
transfectie van grote transgenen (> 7.5 kb).
Celspecifieke polyplexen worden
bekomen door de koppeling van liganden aan het polymeer (Boussif et al., 1995). Een
voorbeeld is transferrine, een ijzertransporterend serum glycoproteïne dat een receptor
op het celoppervlak van prolifererende cellen (oa. tumorcellen) bindt (Kircheis et al.,
1997; Wagner, 1999). Er kan ook onrechtstreeks celspecificiteit bekomen door een
plasmide met een celspecifieke promotor te transfecteren. Cowan et al. gebruikten de
ICAM-2 promotor om een transgen in vasculair endotheel tot expressie te brengen
(Cowan et al., 1996).
In tegenstelling tot virale transfecties, zijn transfecties door middel van polyplexen
transiënt. De in vivo toepassingen van PEI-DNA complexen zijn verder beperkt door
de membraanpermeabiliserende eigenschappen van PEI, die vooral bij hoge
ladingsverhoudingen cellulaire toxiciteit veroorzaken (Godbey et al., 2001; Dubruel et
al., 2003a en b). De interactie van de complexen met serumproteïnen beperkt in vivo
de transfectie-efficiëntie (Dubruel, 2003; Schmidt-Wolf en Schmidt-Wolf, 2003). Dit
kan enerzijds opgelost worden door het gebruik van hogere IPEC concentraties, wat
echter de toxiciteit niet ten goede komt. Men kan anderzijds de IPEC bereiden bij een
lagere ladingsverhouding, wat dan weer de tranfectie-efficiëntie vermindert (Godbey et
al., 1999a).
49
Het ontsnappen van IPEC uit endolysosomen en de interactie van IPEC met
celmembranen, worden als de meest cruciale stappen in het transfectieproces
beschouwd (Pouton en Seymour, 2001). Dit geldt ook voor de polymeren die gebruikt
worden voor de internalisering van farmaceutica en proteïnen (Duncan, 2003; Stayton
et al., 2000). Om de efficiëntie van polymeervectoren te verhogen, is het noodzakelijk
om methoden te ontwikkelen die het ontsnappen uit de endolysosomen katalyseren.
50
1.3.2. Polymethacrylaten: vinylpolymeren voor DNA-transfectie
De relatief hoge transfectie-efficiëntie van polyethyleenimine (PEI) toont aan dat
polymeren potentiële mogelijkheden bieden voor gentherapie. De toepasbaarheid van
PEI blijft echter beperkt omwille van zijn cytotoxiciteit. Om deze reden worden in de
Onderzoeksgroep Polymeermaterialen van de Gentse Universiteit (Prof. Dr. Etienne
Schacht) nieuwe, niet toxische transfectiepolymeren ontwikkeld, zoals
polymethacrylaten.
Polymethacrylaten die gebruikt worden voor transfecties, zijn lineaire vinylpolymeren
die relatief gemakkelijk kunnen gesynthetiseerd worden via radicalaire polymerisatie.
Door een kettingreactie, geïnitieerd door een radicalaire initiator, worden de
methacrylaat monomeren gepolymeriseerd (Fig. 13-B) (Dubruel et al., 2000).
Polymethacrylaten zijn, in analogie met PEI, partieel positief geladen bij fysiologische
pH = 7.4 doordat ze tertiaire aminogroepen (DMAEMA) bevatten. De polykationen
interageren elektrostatisch met negatief geladen DNA, waardoor IPEC gevormd
worden. Door de complexvorming wordt DNA gecondenseerd (40 tot 100 nm) en
worden de negatieve ladingen van het DNA geneutraliseerd (van de Wetering et al.,
1998; Dubruel et al., 2000 en 2002). De efficiëntie van DNA-condensatie neemt toe
met de moleculaire massa van polymethacrylaten en met de relatieve hoeveelheid
positief geladen tertiaire aminogroepen (Dubruel et al., 2003a).
De polymethacrylaat-DNA complexen hebben een netto positieve lading, wat de
interacties met het celoppervlak en opname via endocytose mogelijk maakt (Dubruel et
al., 2002). In een zuur milieu worden polymethacrylaten verder geprotoneerd
(Dubruel et al., 2000), waardoor ze in staat zijn om het zure endosomale milieu te
bufferen, in analogie met de protonenspons PEI. De aciditeitsconstante (pKa) en de
buffercapaciteit van polymethacrylaten worden gevarieerd door de keuze van
methacrylaatester monomeren met veschillende functionele zijgroepen (Fig. 13-C).
Polymethacrylaten die alleen tertiaire aminogroepen (DMAEMA) bevatten, hebben
een lagere buffercapaciteit dan polymethacrylaten die, naast tertiaire aminogroepen,
51
HN
A
...
CH
C
H2
...
CH
C
H2
HN
...
CH
C
H2
CH
C
H2
CH
H2
HN C
N
CH
C
H2
CH
C
H2
N
CH
C
H2
CH
C
H2
CH
C
H2
N C
CH
H2
CH
H2
N C
CH
C
H2
CH3
CH
C
H2
N
...
CH
C
H2
N
...
CH3
AIBN
n CH 2 C
...
CH
C
H2
CH 2
CH
NH
...
B
...
CH
C
H2
CH
H2
N C
...
N
CH
C
H2
CH
C
H2
...
CH
C
H2
[ CH 2 C ] n
C O
C O
O
O
R
R
C
R=
H
MA
(methaycrylzuur, Eng. methacrylic acid)
(CH2)2
NH2
AEMA
(aminoëthyl-methacrylzuur)
(CH2)2
N(CH3)2
DMAEMA
(dimethyl-aminoëthyl-methacrylzuur)
HYMIMMA
(methyl-imidazoyl-methyl-methacrylzuur)
HENIMA
((hydroxyethyl)nicotinamide-methacrylzuur)
N
CH2
NH
H3C
(CH2)2
O
NH C
N
Figuur 13. A, De structuur van vertakt polyethyleenimine (PEI); B, Reactieschema voor de
radicalaire polymerisatie van methacrylaten; C, De structuur van de functionele zijgroepen van
transfectiepolymethacrylaten en de benaming van de corresponderende monomeren.
52
ook zure (MA) of pyridine (HENIMA) functionele zijgroepen (pKa = 5 à 6) bevatten.
De imidazol (HYMIMMA) bevattende polymethacrylaten hebben de grootste
buffercapaciteit, vergelijkbaar met die van PEI (Dubruel et al., 2000).
Enkel de volledig geprotoneerde polymethacrylaten die tertiaire aminogroepen
(DMAEMA) bevatten, zijn in staat om cellen te transfecteren. De bufferende, partieel
ongeladen co-polymeren transfecteren daarentegen niet.
Bovendien krimpen
polymethacrylaat-DNA complexen bovendien bij lage pH, in tegenstelling tot PEI.
Deze data suggereren dat de protonenspons niet het enige criterium is om een
efficiënte polymethacrylaattransfectie te bekomen (Dubruel et al., 2003a).
In tegenstelling tot PEI-DNA complexen, zijn polymethacrylaat-DNA complexen niet
cytoxisch of hemolytisch (Dubruel et al., 2003a), waardoor ze toch een potentieel
bezitten voor gentherapie.
53
1.3.3. Biodegradeerbare polymeren voor DNA-transfectie
De toxiciteit van polyplexen kan voorkomen worden door het gebruik van
biodegradeerbare polymeren, zoals peptidevectoren. Naast poly-L-Lysine (PLL), het
best gekende voorbeeld, werden ook poly-L-Glutamaten ontwikkeld voor DNAtransfectie (Dekie et al., 2000). Ondanks hun lage cytotoxiciteit en goede bufferende
eigenschappen, is het gebruik van deze peptidevectoren beperkt omwille van hun lage
transfectie-efficiëntie (Dubruel et al., 2003b en c). Dit toont opnieuw aan dat de
protonenspons niet het enige cruciale criterium is bij de ontwikkeling van
transfectiepolymeren.
Recent werden PLL-DNA complexen gecombineerd met membraan permeabiliserende
peptiden om het ontsnappen van de polyplexen uit de endosomen te katalyseren.
Daardoor neemt de transfectie-efficiëntie toe (Wagner, 1999; Sparrow et al., 1998).
Het gebruik van membraanpermeabiliserende peptiden impliceert echter cytotoxiciteit.
54
2
Doelstellingen
55
Celpenetrerende peptiden (CPP) zijn wateroplosbare, niet-toxische peptiden die
gebruikt worden voor de efficiënte internalisering van hydrofiele cargomoleculen in
eukaryote cellen. Penetratin is het CPP dat overeenkomt met de derde helix van het
DNA-bindende domein van het Antennapedia homeoproteïne uit Drosophila.
Homeoproteïnen zijn essentiële transcriptiefactoren in zowel de vroege ontwikkeling,
als in latere stadia van de levenscyclus.
Homeoproteïnen zijn ook paracriene
boodschappers die intercellulair worden uitgewisseld via nog ongekende secretie- en
internaliseringsmechanismen.
Ondanks het grote toepassingsgebied van de Penetratin vector, is het
internaliseringsmechanisme van dit peptide nog onduidelijk. Volgens het hypothetisch
internaliseringsmodel van Prochiantz et al. (Derossi et al., 1996; Prochiantz, 1996),
wordt Penetratin opgenomen via een directe interactie met de plasmamembraan. Bij
dit proces spelen de tryptofaan residu’s een cruciale rol spelen.
De
membraantranslocatie gebeurt door de vorming van omgekeerde micellen in de
lipidendubbellaag van de membraan. Dit model kan de internalisering van kleine
hydrofiele cargo’s door de Penetratin vector verklaren, maar niet die van volledige
homeoproteïnen.
De eerste doelstelling van dit werk bestond uit de karakterisering van het
internaliseringsmechanisme van Penetratin. Deze studie draagt ook bij tot het beter
begrijpen van de internalisering van homeoproteïnen en van CPP in het algemeen.
De eigenschappen van het peptide die bepalend zijn voor de interactie van Penetratin
met lipidendubbellagen en met levende cellen, werden geïdentificeerd door de
synthese van nieuwe Penetratin varianten. Derossi et al. toonden aan dat Trp48 en
Trp56 cruciaal zijn voor de internalisering van het Penetratin peptide (Derossi et al.,
1994).
Omdat tryptofaan residu’s in het algemeen peptide-lipiden interacties
bevorderen (Wimley en White, 1996; Yau et al., 1998), werd het relatieve belang van
Trp48 en Trp56 onderzocht door synthese van de W48F- en W56F-Penetratin
varianten, waarbij de tryptofaan residu’s individueel vervangen zijn door fenylalanine.
Celpenetrerende peptiden zijn bij fysiologische pH positief geladen door de
aanwezigheid van positief geladen lysine en arginine residu’s. Het belang van deze
56
residu’s werd onderzocht door een systematische substitutie naar alanine. Hierdoor
werd ook de bijdrage van de amfipaticiteit en van de elektrostatische en hydrofobe
interacties bestudeerd.
Door middel van fysicochemische technieken werden de lipideninteracties van de
nieuwe Penetratin varianten met al dan niet negatief geladen, unilamellaire vesikels als
model voor lipidendubbellagen onderzocht. Hiervoor werden de affiniteit van de
Penetratin varianten voor deze vesikels, hun secundaire structuur, hun insertiediepte in
de lipidendubbellaag en hun membraandestabiliserende eigenschappen bepaald.
De opname-efficiëntie en de sub-cellulaire lokalisatie van de nieuwe Penetratin
varianten in levende cellen werden bepaald door flow cytometry en confocale
microscopie.
In het tweede deel van dit werk werd het toepassingsgebied van Penetratin uitgebreid
voor DNA-transfecties. De spontane opname van polynucleotiden door cellen wordt
immers verhinderd door hun negatieve lading, door hun grote hydrodynamische
volume en door enzymatische afbraak. Om deze problemen te vermijden, moeten de
polynucleotiden gecombineerd worden met een transfectievector. Het Penetratin
peptide komt hiervoor echter niet in aanmerking, omdat de aspecifieke elektrostatische
interactie van Penetratin met de polynucleotiden de internalisering in cellen blokkeert.
Deze aspecifieke interactie kan voorkomen worden door de polynucleotiden vooraf te
complexeren met polykationische polymeren, zoals kationische polymethacrylaten.
Deze vinyl polymeren neutraliseren de negatieve ladingen van polynucleotiden en
condenseren het DNA, waardoor het beschermd wordt tegen afbraak door nucleasen.
Daarnaast bufferen deze polymeren het endosomaal pH gebied, in analogie met de
polyethyleenimine (PEI) protonenspons. Alhoewel deze polymeren niet toxisch zijn
voor cellen, hebben ze een lage transfectie-efficiëntie.
Om een efficiënt, niet toxisch transfectiesysteem te bekomen, werden in dit werk de
membraantranslocatie eigenschappen van Penetratin gecombineerd met de DNAcondenserende en bufferende eigenschappen van polymethacrylaten.
De invloed van het Penetratin peptide op de DNA-condensatie en de
ladingsneutralisatie door polymethacrylaten werd fysicochemisch bestudeerd. De
57
transfectie-efficiëntie, de cytotoxiciteit en de sub-cellulaire lokalisatie van
polymethacrylaat-DNA-Penetratin complexen werden onderzocht op levende cellen.
58
3
Studie van het
internaliseringsmechanisme
van Penetratin peptiden
59
3.1.
De interacties van Penetratin peptiden met de
lipidendubbellaag van vesikels
De resultaten van de studie van het internaliseringsmechanisme van Penetratin
peptiden werden gepubliceerd in European Journal of Biochemistry (cf. bijlagen 1).
De basisprincipes van de fysicochemiche experimenten voor de studie van de peptidelipiden interacties, worden beschreven in bijlage 3 van dit hoofdstuk.
In deze paragraaf wordt de studie van de lipideninteracties van Penetratin peptiden
samengevat.
De lipidendubbellaag van de unilamellaire vesikels bestond
hoofdzakelijk uit zwitterionisch fosfatidylcholine (PC) uit eigeel. Om het belang van
de lading van de membraan na te gaan, werden natuurlijke, negatief geladen
fosfolipiden, zoals fosfatidylserine (PS) uit rundhersenen, synthetisch 1,2-dimyristoylsn-glycero-3-fosfaat (DMPA), synthetisch 1-palmitoyl-2-oleolyl-s n-glycero-3fosfoglycerol (PG) en fosfatidylinositol (PI) uit rundhersenen in de lipidendubbellaag
van de vesikels geïncorporeerd.
Tabel 3. Aminozuursequentie, gemiddelde hydrofobiciteit <H0> en helicaal hydrofoob moment <µH>
van de Penetratin varianten. De positief geladen residu’s zijn weergegeven in blauw, de
aromatische residu’s in groen. De aminozuursubstituties zijn onderlijnd en in vet aangeduid.
Penetratin variant
Sequentie
<H0>
<µH>
wild type (pAntp43-58)
RQIKIWFQNRRMKWKK
-0.61
0.29
W48F
W56F
RQIKIFFQNRRMKWKK
RQIKIWFQNRRMKFKK
-0.58
-0.58
0.31
0.31
K46A/R53A
K46A/K57A
R53A/K57A
R52A/K55A
RQIAIWFQNRAMKWKK
RQIAIWFQNRRMKWAK
RQIKIWFQNRAMKWAK
RQIKIWFQNARMAWKK
-0.28
-0.34
-0.28
-0.28
0.34
0.21
0.29
0.57
De specifieke bijdrage van residu’s Trp48 en Trp56 werd onderzocht door synthese
van de W48F en W56F Penetratin varianten. Het belang van de positief geladen
arginine en lysine residu’s werd bestudeerd door de synthese van varianten met
60
dubbele R,K-A substituties. De sequentie, de gemiddelde hydrofobiciteit en het
helicaal hydrofoob moment van de varianten, berekend volgens de consensus
hydrofobiciteitsschaal van Eisenberg (Eisenberg et al., 1984), worden weergegeven in
Tabel 3.
Penetratin peptiden vormen random gestructureerde monomeren in
buffer
Lipidenvrije Penetratin peptiden die opgelost zijn in een waterige buffer, vertonen een
maximale tryptofaan fluorescentie emissie bij 346 - 347 nm en waterfase
quenchingconstanten die vergelijkbaar zijn met die van een waterige oplossing van het
aminozuur tryptofaan. Dit suggereert dat de tryptofaan residu’s van Penetratin
peptiden naar de polaire omgeving van de buffer gericht zijn. De Penetratin peptiden
zijn in buffer dus niet geaggregeerd en komen voor als monomeren. Circulair
dichroisme metingen tonen aan dat de Penetratin monomeren een random structuur
hebben in een waterig milieu. Dit komt overeen met recente studies (Berlose et al.,
1996; Drin et al., 2001a; Magzoub et al., 2001; Persson et al., 2001; Magzoub et al.,
2002; Letoha et al., 2003; Lindberg et al., 2003; Magzoub et al., 2003).
De initiële binding van Penetratin peptiden met lipidendubbellagen is
elektrostatisch
Incubatie van Penetratin peptiden met zwitterionische PC SUV veroorzaakt geen blue
shift van de maximale tryptofaan fluorescentie emissiegolflengte. De waterfase
quenchingconstanten zijn bovendien vergelijkbaar met die van de lipidenvrije
peptiden. Dit suggereert dat de tryptofaan residu’s niet diep geborgen zitten in de
hydrofobe kern van de lipidendubbellaag en dat slechts een zwakke binding van
Penetratin met zwitterionische vesikels optreedt.
De incubatie van wild type Penetratin met negatief geladen SUV, bestaande uit een
mengsel van zwitterionisch PC en minstens 20% negatief geladen PS, gaat gepaard
61
met een blue shift van de maximale tryptofaan fluorescentie emissiegolflengte ( > 10
nm) en een daling van de waterfase quenchingconstanten. Dit wijst op de insertie van
de tryptofaan residu’s van het peptide in de lipidendubbellaag van de vesikels (Berlose
et al., 1996; Magzoub et al., 2001, 2002 en 2003).
Er treedt ook een daling van de tryptofaan fluorescentie emissie-intensiteit op, die de
berekening van schijnbare dissociatie constanten (Kd) toelaat. Wild type Penetratin
heeft een hoge affiniteit voor negatief geladen SUV met minstens 20% PS (Kd <
10µM).
De enkelvoudige W48F en W56F varianten vertonen een blue shift en een affiniteit
vergelijkbaar met die van wild type. De tryptofaan residu’s spelen dus geen primaire
rol in de initiële interactie van Penetratin met lipidendubbellagen. Omdat de W48F
variant een kleinere blue shift en een lagere affiniteit heeft dan de W56F variant,
interageert residu Trp48 sterker met lipiden dan Trp56.
De dissociatieconstanten voor de binding van wild type, W48F en W56F Penetratin
peptiden aan PC/PS/chol (70:20:10) SUV, zijn een factor 10 hoger dan voor de binding
aan PC/PS (80:20) SUV. Ondanks de lagere affiniteit, blijven de blue shift en de
waterfase quenching significant, wat aantoont dat de binding niet compleet wegvalt.
De affiniteitsdaling kan verklaard worden doordat de natuurlijke fosfolipiden (PC uit
eigeel en PS uit runderhersenen) overwegend onverzadigde acylketens bevatten
(Avanti Polar Lipids website, 2004). Door het toevoegen van cholesterol kan de
rigiditeit van de acylketens toenemen, wat resulteert in een lagere affiniteit. Een
vergelijkbaar effect werd vastgesteld bij de interactie van Nisin en Magainin peptiden
met PC/chol (El Jastimi et al., 1999; Wieprecht et al., 1999).
In vergelijking met wild type, veroorzaken de dubbele K46A/R53A, K46A/K57A,
R53/K57A en R52A/K55A substituties een toename in de hydrofobiciteit en een 30voudige daling in de affiniteit voor PC/PS (70:30) SUV, alhoewel een blue shift van 5
à 10 nm behouden blijft.
De affiniteit voor PC/PS (80:20) vesikels daalt bovendien ook met een factor 10 à 100,
bij het uitvoeren van titraties in buffers met respectievelijk 0.5 en 1 mM NaCl, in
plaats van 0.15 mM NaCl. Bij deze hoge zoutconcentraties bedraagt de blue shift
slechts 1 tot 3 nm.
62
Er kan dus besloten worden dat de initiële binding van Penetratin peptiden met
negatief geladen fosfolipidenmembranen overwegend elektrostatisch is, wat te
verwachten was voor peptiden met een pI van 12.3. Het hydrofoob effect is van
ondergeschikt belang, maar kan niet volledig uitgesloten worden. Analoge resultaten
werden recent bekomen door andere groepen (Berlose et al., 1996; Bellet-Amalric et
al., 2000; Drin et al., 2001a en b; Magzoub et al., 2001; Persson et al., 2001; Magzoub
et al., 2002; Binder en Lindblom, 2003; Dom et al., 2003; Lindberg et al., 2003;
Magzoub et al., 2003; Persson et al., 2003; Salamon et al., 2003; Andersson et al.,
2004).
De lipidenbinding induceert de α-helicale structuur van Penetratin
peptiden
In de hydrofobe omgeving van het organische solvent trifluoro-ethanol (TFE) of in
waterige mengsels van dit solvent, nemen Penetratin peptiden een α-helicale structuur
aan. Dit is ook het geval voor andere solventen met een lage diëlektrische constante
(Berlose et al., 1996; Drin et al., 2001a; Magzoub et al., 2001 en 2003; Letoha et al.,
2003) en wijst erop dat Penetratin peptiden geneigd zijn om een α-helicale structuur
aan te nemen in een hydrofobe omgeving (Lehrman et al., 1990).
Bij incubatie met zwitterionische PC vesikels, hebben Penetratin peptiden circulair
dichroisme spectra met de karakteristieken van een random structuur. Dit werd
verwacht gezien de lage affiniteit van Penetratin voor zwitterionische membranen.
De binding van wild type Penetratin en van de varianten met enkelvoudige W-F en de
dubbele R,K-A substituties met negatief geladen PC/PS SUV, gaat bij lage
peptide/lipide verhoudingen (P/L = 0.02) gepaard met de inductie van de α-helicale
structuur.
Ondanks zijn hoge affiniteit voor PC/PS SUV, blijft de 3Pro
(I45P/Q50P/K55P) variant (RQPKIWFPNRRMPWKK) random bij lipidenbinding of
in TFE. Analoge resultaten werden bekomen met andere negatief geladen vesikels
(PC/PA, PC/PG of PC/PI) en door andere groepen (Drin et al., 2001a; Persson et al.,
63
2001; Letoha et al., 2003; Lindberg et al., 2003; Magzoub et al., 2003; Persson et al.,
2003).
Magzoub et al. rapporteerden een α−β conformationele verandering bij stijgende
peptide/lipide verhoudingen (P/L 0.002 - 0.06) en bij vesikels met een hoge
ladingsdichtheid (Magzoub et al., 2001 en 2002). In onze studie neemt het percentage
α-helix af bij hogere peptide/lipide verhoudingen (P/L = 0.05), zonder dat de circulair
dichroisme spectra de karakteristieken van een β-structuur vertonen. De circulair
dichroisme metingen werden bij lagere peptide/lipide verhoudingen (P/L < 0.02)
verstoord door de turbiditeit van het stalen door de overmaat aan lipiden. De accurate
interpretatie van de spectra wordt bij hogere peptide/lipide verhoudingen (P/L > 0.05)
bemoeilijkt door een significante hoeveelheid lipidenvrij peptide (meer dan 30% voor
de dubbele R,K-A varianten). Het dient opgemerkt dat Magzoub et al. de relatieve
hoeveelheid van de secundaire structuren berekenden door vergelijking met een
databank van proteïnenspectra, waardoor over-interpretatie van de Penetratinspectra
mogelijk is. De discrepantie kan ook verklaard worden door de verschillende negatief
geladen fosfolipiden (PS vs. PG) die gebruikt werden (Terrone et al., 2003).
De Penetratin helix interageert met de fosfolipidehoofdgroepen
Bij de insertie van tryptofaan in de hydrofobe omgeving van lipidendubbellagen of in
de hydrofobe kern van proteïnen, gaat een blue shift van de maximale tryptofaan
fluorescentie emissiegolflengte meestal gepaard met een toename van de tryptofaan
fluorescentie emissie-intensiteit (Udenfried S., 1969). De binding van Penetratin met
PC/PS SUV veroorzaakt echter een daling van de tryptofaan emissie-intensiteit
(Persson et al., 2003). Om het quenchingmechanisme op te helderen werden
tryptofaan fluorescentie leeftijdsmetingen uitgevoerd.
De tryptofaan fluorescentie van Penetratin peptiden heeft drie leeftijden die
overeenkomen met de drie rotameren van de chi1 (Cα-Cβ) binding en die kunnen
omgerekend worden naar de gemiddelde leeftijd. Zowel in de lipidenvrije, als in de
lipidengebonden peptiden, komt deze leeftijd van wild type Penetratin overeen met het
64
gemiddelde van die van de W48F en W56F varianten. Beide tryptofaan residu’s
interageren dus niet met elkaar, noch direct door energie transfer, noch indirect door
conformationele veranderingen.
Quenching van Trp fluorescentie in peptiden en proteïnen kan worden veroorzaakt
door interacties met de carbonyl van de peptidenbinding en de geladen aminogroepen
van arginine en lysine zijketens (Hasselbacher et al., 1995; Clark et al., 1996; Chen en
Barkley, 1998).
De
3Pro
(I45P/Q50P/K55P)
Penetratin
variant
(RQPKIWFPNRRMPWKK), die niet in staat is om een α-helicale structuur aan te
nemen (cf. supra), vertoont een leeftijdsdaling in trifluoro-ethanol (TFE).
De
leeftijdsdaling die geobserveerd werd voor de α-helicale wild type, W48F en W56F
Penetratin peptiden in TFE, wordt bijgevolg veroorzaakt door het organische solvent
en niet door interacties van tryptofaan met de peptidenbinding door vorming van de αhelicale secundaire structuur.
De binding van wild type, W48F en W56F Penetratin peptiden met negatief geladen
PC/PA SUV, induceert een α-helicale structuur, zoals ook het geval is bij PC/PS SUV.
Bij binding aan PC/PA SUV treedt echter geen fluorescentie intensiteits- en
leeftijdsdaling op. De tryptofaan quenching die optreedt bij binding aan PC/PS SUV,
wordt dus niet veroorzaakt door conformationele veranderingen waarbij de
quenchende arginine en lysine zijketens interageren met de tryptofaan residu’s.
De fluorescentie intensiteits- en leeftijdsdaling bij binding van Penetratin peptiden aan
PC/PS SUV, kan bijgevolg alleen verklaard worden door interacties van de tryptofaan
residu’s met de serinehoofdgroepen, die zowel quenchende carbonyl- als
aminogroepen
bevatten.
De
directe
interactie
van
Penetratin
met
fosfolipidehoofdgroepen werd ook aangetoond in andere studies (Berlose et al., 1996;
Binder en Lindblom, 2003; Salamon et al., 2003).
Penetratin peptiden vertonen echter geen hoofdgroepspecificiteit bij de initiële
elektrostatische lipidenbinding. Er treedt immers Trp fluorescentie blue shift en
inductie van de α-helicale conformatie op bij de binding van Penetratin peptiden met
verschillende types negatief geladen vesikels (PC/PS, PC/PA, PC/PG of PC/PI SUV).
65
Penetratin peptiden bevinden zich in het water-lipiden grensvlak van
fosfolipidendubbellagen
Blue shift van de maximale tryptofaan fluorescentie emissiegolflengte is indicatief voor
peptideninsertie in lipidendubbellagen, maar is niet evenredig met de insertiediepte
(London, 1994). De insertiediepte kan nauwkeuriger bepaald worden door lipidenfase
quenching.
De binding van wild type Penetratin met PC/PS (70:30) SUV, gaat gepaard met een
lipidenfase quenching die efficiënter is voor Br6,7-PC dan voor Br11,12-PC.
De
tryptofaan residu’s van wild type Penetratin bevinden zich dus tegen het water-lipiden
grensvlak en dringen niet diep in de hydrofobe kern van de lipidendubbellaag binnen.
Dit stemt overeen met de preferentiële lokalisatie van Trp aan het water-lipiden
grensvlak (White en Wimley, 1999). Analoge resultaten werden bekomen voor de
W48F en W56F Penetratin varianten.
Overeenkomstig de blue shift waarden, is de lipidenfase quenching efficiënter voor de
W56F dan voor W48F Penetratin. Dit suggereert dat Penetratin peptiden schuin
georiënteerd zijn in de lipidendubbellaag, waarbij Trp48 dieper geborgen is in de
membraan dan Trp56 (Fig. 14). Dit werd ook aangetoond door andere groepen
(Brattwall et al., 2003; Lindberg et al., 2003; Magzoub et al., 2003; Salamon et al.,
2003).
In vergelijking met wild type Penetratin, vertonen de R53A/K57A en R52A/K55A
Penetratin varianten een significante daling in waterfase quenchingefficiëntie, terwijl
de lipidenfase quenching toeneemt, zowel door Br6,7-PC als door Br11,12-PC. Deze
varianten penetreren dus dieper in de lipidendubbellaag dan wild type Penetratin.
Het hydrofoob effect speelt een belangrijke rol bij de destabilisatie van
fosfolipidendubbellagen door Penetratin peptiden
De efficiëntie waarmee wild type Penetratin en de W48F en W56F varianten PC/PS
(70:30) LUV permeabiliseren is laag in vergelijking met het cytotoxische en
hemolytische Melittin peptide. Dit toont aan dat Penetratin peptiden geen poriën
vormen in de vesikelmembranen (Berlose et al., 1996; Derossi et al., 1996; Thoren et
66
al., 2000; Drin et al., 2001a en b; Persson et al., 2003; Salamon et al., 2003; Terrone et
al., 2003).
Figuur 14. A, 3D structuur van wild type Penetratin, corresponderend met de NMR structuur van
het Antennapedia homeodomain gecomplexeerd met zijn DNA (PDB code 1ahd, model 1, residu’s
43-58); B, Samenvatting en schematische voorstelling van de interacties van wild type Penetratin
en varianten met negatief geladen fosfolipidemembranen.
Wild type, W48F en W56F Penetratin induceren bovendien aggregatie van negatief
geladen PC/PS (70:30) LUV, in overeenkomst met andere groepen (Persson et al.,
2001; Andersson et al., 2004). Omdat de vesikelaggregatie niet gepaard gaat met
membraanpermeabilisatie en omdat Penetratin peptiden geen geaggregeerde β-
67
structuren vormen, gedragen Penetratin peptiden zich niet als fusogene, schuin
georiënteerde peptiden (Brasseur et al., 1997; Magzoub et al., 2003).
Ondanks hun lagere affiniteit voor negatief geladen vesikels, veroorzaken de
K46A/R53A, K46A/K57A, R53A/K57A en R52A/K55A substituties toch meer
membraanpermeabilisatie dan wild type Penetratin. Deze varianten veroorzaken noch
aggregatie, noch desintegratie van vesikels, zodat het detergent model voor
membraanpermeabilisatie uitgesloten is (Persson et al., 2001). De R53A/K57A en
R52A/K55A varianten hebben dubbele R,K-A substituties in de buurt van Trp56.
Deze substituties verhogen de gemiddelde hydrofobiciteit, maar niet de amfipaticiteit
van het Penetratin peptide (Tabel 3 en Fig. 14-A). Deze varianten dringen dieper
binnen in de lipidendubbellaag dan wild type Penetratin (cf. supra) en hebben de
hoogste permeabilisatie-efficiëntie.
Er kan dus besloten worden dat de insertie van het peptide in de hydrofobe kern van de
lipidendubbellaag en de daaraan gekoppelde membraandestabilisatie, afhankelijk zijn
van de hydrofobe omgeving van Trp56 (Fig. 14-B).
De amfipaticiteit is van
ondergeschikt belang. Dit toont verder aan dat Penetratin peptiden niet behoren tot de
‘klassieke’ membraanpermeabiliserende peptiden. Drin et al. bekwamen analoge data
voor de AP-2AL variant (N51A/R52A/K55L substituties) (Drin et al., 2001a), terwijl
Persson et al. ook het belang van het hydrofoob effect voor de overgang van het
Penetratin peptide van het water-lipiden grensvlak naar de hydrofobe kern van de
membraan aantoonden (Persson et al., 2003).
In tegenstelling tot Drin et al. slaagden we er in dit werk niet in om de translocatie van
de permeabiliserende Penetratin varianten (Drin et al., 2001a) en de fosfolipide flipflop (cf. bijlage 3) in vesikels te bepalen door dithioniet quenching. Door de
permeabilisatie lekt dithioniet doorheen de lipidendubbellaag, wat leidt tot quenching
artefacten. Binder et al. toonden recent de translocatie van Penetratin peptiden in
negatief geladen vesikels echter aan door middel van isothermische titratie calorimetrie
(Binder en Lindblom, 2003). De translocatie kan bovendien verhoogd worden door de
inductie van transmembranaire potentiaalverschillen (Terrone et al., 2003).
68
3.2. De interacties van Penetratin peptiden met cellen
Om de internalisering van de Penetratin varianten in MDCK cellen te bestuderen
zonder voorafgaande fixatie, werden de Penetratin peptiden N-terminaal gemerkt met
fluorescerend nitrobenz-2-oxa-1,3-diazol-4-yl (NBD). De endocytose-onafhankelijke
opname van Penetratin peptiden wordt bestudeerd bij 4°C.
Door middel van
irreversibele dithioniet quenching van de NBD-merker, wordt een onderscheid
gemaakt tussen de intracellulair gelokaliseerde peptiden en de peptiden die
extracellulair geassocieerd zijn met het celoppervlak (cf. bijlage 3) (Drin et al., 2001b;
Richard et al., 2003).
Penetratin peptiden zijn niet toxisch voor cellen
Al dan niet NBD-gemerkte Penetratin peptiden veroorzaken geen lyse van erytrocyten
of MDCK cellen en zijn niet cytotoxisch, in tegenstelling tot Melittin (Hallbrink et al.,
2001; Drin et al., 2003). Dit toont opnieuw aan dat membraantranslocatie van
Penetratin in cellen niet kan verklaard worden door de ‘klassieke’ mechanismen voor
membraanpermeabilisatie.
Penetratin peptiden worden zowel door endocytose als door
membraantranslocatie opgenomen
Confocale microscopie toont aan dat alle NBD-gemerkte Penetratin varianten een
analoge sub-cellulaire lokalisatie in MDCK hebben, met uitzondering van de
K46A/R53A variant.
Deze variant wordt niet geïnternaliseerd en associeert
extracellulair met het celoppervlak.
Bij 37°C zijn de andere Penetratin varianten ter hoogte van de plasmamembraan en
intracellulair gelokaliseerd. De co-lokalisatie van de geïnternaliseerde peptiden met
zure endolysosomen, suggereert opname door endocytose. Dit komt overeen met
69
recente analyses op niet gefixeerde cellen (Fischer et al., 2002; Waizenegger et al.,
2002; Drin et al., 2003; Terrone et al., 2003; Thoren et al., 2003; Fischer et al., 2004).
Bij 4°C worden de Penetratin varianten gedetecteerd aan de plasmamembraan en in het
cytosol. Ze zijn echter niet geassocieerd met zure organellen, wat opname via
membraantranslocatie suggereert.
Zowel bij 37°C als bij 4°C, worden de Penetratin peptiden niet naar de nucleus van
levende, niet gefixeerde MDCK cellen geadresseerd, in tegenstelling tot de uniforme
verdeling van de peptiden in het cytosol en de nucleaire targetting die wij en andere
groepen waarnamen op gefixeerde cellen (Fig. 15-A) (Derossi et al., 1994 en 1996;
Fischer et al., 2000; Drin et al., 2001b). Deze discrepenaties kunnen verklaard worden
door fixatie-artefacten waarbij relokalisatie van kleine peptiden optreedt (Drin et al.,
2003; Richard et al., 2003).
In onze studie vertonen carboxy-fuoresceïne gemerkte Penetratin varianten dezelfde
sub-cellulaire lokalisatie als de NBD-gemerkte peptiden. Dit bewijst dat het type
fluorescente merker weinig invloed heeft op de sub-cellulaire lokalisatie van de
peptiden in MDCK cellen, zoals ook door Fischer et al. werd aangetoond (Fischer et
al., 2002).
De sub-cellulaire lokalisatie is daarentegen wel afhankelijk van het celtype (Fischer et
al., 2004).
Dit wordt geïllustreerd door de uniforme verdeling van NBD- en
carboxyfluoresceïne-gemerkte Penetratin peptiden in het cellichaam van levende
primaire neuronen uit rattenhersenen (Fig. 15-B).
70
A
B
Cellichaam
Figuur 15. A, Epifluorescentie microscopie van gefixeerde MDCK cellen, 30 min. geïncubeerd met 5
µM gebiotinyleerd wild type Penetratin bij 4°C, na fixatie in ethanol/azijnzuur gedetecteerd met
Streptavidine-FITC; B, Confocale microscopie van levende primaire ratneuronen, 30 min.
geïncubeerd met 10 µM NBD-gemerkt wild type Penetratin bij 37°C (Rechts: fase-contrast beeld;
links: fluorescentie beeld, waarbij groen correspondeert met NBD fluorescentie).
71
Trp48 en de hydrofobe omgeving van Trp56 spelen een belangrijke rol bij
de opname van Penetratin peptiden
Flow cytometry toont aan dat de opname-efficiëntie van NBD-gemerkt wild type
Penetratin in levende MDCK cellen bij 4°C tien keer lager is dan bij 37°C. Dit komt
overeen
met
recente
publicaties
waarbij
ook
een
daling
van
de
internaliseringsefficiëntie werd vastgesteld bij 4°C, bij het stilleggen van het ATPmetabolisme of bij het verhinderen van endosomale acidificatie (Drin et al., 2003;
Letoha et al., 2003; Thoren et al., 2003; Fischer et al., 2004).
De W48F substitutie vermindert de internalisering van Penetratin bij 4°C, terwijl dit
effect minder uitgesproken is voor de W56F substitutie. In tegenstelling tot de
interacties met modelmembranen, is Trp48 dus functioneel belangrijker dan Trp56
voor de endocytose-onafhankelijke membraantranslocatie van Penetratin peptiden.
Een analoog effect werd waargenomen door Drin et al. en Fischer et al. voor de W48A
en W48K substituties (Drin et al., 2001b; Fischer et al., 2002). Dit wordt verder
ondersteund door de hogere conserveringsgraad van residu Trp48 (>95% in 346
homeodomeinen), in vergelijking met Trp56 (32% conservering) (Gehring et al.,
1994a; Prochiantz, 1996).
In overeenkomst met de extracellulaire binding op het celoppervlak, wordt de
K46A/R53A variant noch bij 37°C, noch bij 4°C opgenomen. De K46A/K57A,
R53A/K57A en R52A/K55A varianten, waarbij minstens een lysine residu in de buurt
van Trp56 werd vervangen door een alanine (Tabel 3 en Fig. 14-A), worden bij 4°C
opgenomen met een efficiëntie die vergelijkbaar is met die van wild type Penetratin.
De endocytose-onafhankelijke membraantranslocatie in cellen is dus ook afhankelijk
van de hydrofobe omgeving van Trp56.
De fysicochemische studie van de
membraaninteracties (cf. supra) suggereert dat de daling van de initiële elektrostatische
binding van de K46A/K57A, R53A/K57A en R52A/K55A varianten met de
celmembranen,
wordt
gecompenseerd
door
een
toename
in
hun
membraandestabiliserende eigenschappen. Dit resulteert in een opname-efficiëntie die
vergelijkbaar is met die van wild type Penetratin. De amfipaticiteit blijkt van
ondergeschikt belang te zijn, zoals ook het geval is voor de opname van de KLA
Modelpeptiden (Scheller et al., 2000).
72
3.3. Bijlagen
Tryptophan fluorescence study of the interaction of penetratin peptides with
model membranes
Bart Christiaens, Sofie Symoens, Stefan Verheyden, Yves Engelborghs, Alain Joliot,
Alain Prochiantz, Joël Vandekerckhove, Maryvonne Rosseneu and Berlinda Vanloo
Eur. J. Biochem. 269, 2918-2926 (2002)
Membrane interaction and cellular internalization of penetratin peptides
Bart Christiaens, Johan Grooten, Michael Reusens, Alain Joliot, Marc Goethals, Joël
Vandekerckhove, Alain Prochiantz and Maryvonne Rosseneu
Eur. J. Biochem. 271, 1187-1197 (2004)
Basisprincipes van de fysicochemische studie van peptide-lipideninteracties
Bart Christiaens
73
Eur. J. Biochem. 269, 2918–2926 (2002) FEBS 2002
doi:10.1046/j.1432-1033.2002.02963.x
Tryptophan fluorescence study of the interaction of penetratin
peptides with model membranes
Bart Christiaens1, Sofie Symoens1, Stefan Vanderheyden2, Yves Engelborghs2, Alain Joliot3,
Alain Prochiantz3, Joël Vandekerckhove4, Maryvonne Rosseneu1 and Berlinda Vanloo1
1
Laboratory for Lipoprotein Chemistry and 4Flanders Interuniversity Institute for Biotechnology, Department of Medical Protein
Research, Faculty of Medicine, Department of Biochemistry, Ghent University, Belgium; 2Laboratory of Biomolecular Dynamics,
Katholieke Universiteit Leuven, Belgium; 3Ecole Normale Supe´rieure, Paris, France
Penetratin is a 16-amino-acid peptide, derived from the
homeodomain of antennapedia, a Drosophila transcription
factor, which can be used as a vector for the intracellular
delivery of peptides or oligonucleotides. To study the relative
importance of the Trp residues in the wild-type penetratin
peptide (RQIKIWFQNRRMKWKK) two analogues, the
W48F (RQIKIFFQNRRMKWKK) and the W56F (RQI
KIWFQNRRMKFKK) variant peptides were synthesized.
Binding of the three peptide variants to different lipid vesicles
was investigated by fluorescence. Intrinsic Trp fluorescence
emission showed a decrease in quantum yield and a blue shift
of the maximal emission wavelength upon interaction of the
peptides with negatively charged phosphatidylserine, while
no changes were recorded with neutral phosphatidylcholine
vesicles. Upon binding to phosphatidylcholine vesicles containing 20% (w/w) phosphatidylserine the fluorescence blue
shift induced by the W56F-penetratin variant was larger
than for the W48F-penetratin. Incorporation of cholesterol
into the negatively charged lipid bilayer significantly
decreased the binding affinity of the peptides. The Trp mean
lifetime of the three peptides decreased upon binding to
negatively charged phospholipids, and the Trp residues were
shielded from acrylamide and iodide quenching. CD measurements indicated that the peptides are random in buffer,
and become a helical upon association with negatively
charged mixed phosphatidylcholine/phosphatidylserine
vesicles, but not with phosphatidylcholine vesicles. These
data show that wild-type penetratin and the two analogues
interact with negatively charged phospholipids, and that this
is accompanied by a conformational change from random to
a helical structure, and a deeper insertion of W48 compared
to W56, into the lipid bilayer.
Homeoproteins are transcription factors, first discovered in
Drosophila melanogaster, which are involved in multiple
morphological processes [1]. A 60-residue DNA-binding
domain, named homeodomain, which consists of three
a helices and one b turn between helices 2 and 3 was
identified in these proteins [2]. The homeodomain of
antennapedia (a Drosophila homeoprotein) was shown to
translocate through the plasma membrane of cultured
neuronal cells, to reach the nucleus and to induce changes in
the cellular morphology [3,4]. It was recently shown that the
translocation properties of helix 3 are similar to those of the
entire homeodomain [5]. Prochiantz et al. [6–8] proposed to
use the penetratin peptide, corresponding to residues 43–58
of the homeodomain, as a vehicle for the intracellular
delivery of hydrophilic cargo molecules [e.g. oligopeptides
[9], oligonucleotides [10] and peptidic nucleic acids (PNA)
[11]]. The mechanism for the peptide translocation through
the cellular membrane remains unclear. Chemical modifications of the penetratin peptide have shown that translocation does not require interactions with chiral receptors or
enzymes [12]. The two Trp residues at position 48 and 56
play a crucial role in the translocation process, as a variant
peptide with two Trp fi Phe substitutions is not internalized [5], suggesting that internalization does not depend only
upon the peptide hydrophobicity. Peptide translocation
could be explained by formation of inverted micelles, which
is promoted by Trp residues [13]. 31P-NMR spectroscopy
data showed that addition of penetratin to a lipid extract
from embryonic rat brain induced formation of inverted
micelles, whereas this was not observed with synthetic lipid
membranes [14]. Formation of inverted micelles could also
account for the limitation in the length of the cargo that can
be internalized after attachment to the penetratin peptide. It
is unlikely that penetratin would adopt an a helical conformation leading to formation of a positively charged channel,
as the 16-residue peptide is too short to span the plasma
membrane. Derossi et al. could not measure any conductivity that would support channel formation [12]. The WTpenetratin peptide adopts an a helical structure in 30%
(v/v) hexafluoroisopropanol, in perfluoro-tert-butanol and
in the presence of SDS micelles [14]. However the peptide
Correspondence to B. Vanloo, Department Biochemistry,
Laboratory Lipoprotein Chemistry, Ghent University,
Hospitaalstraat 13, 9000 Ghent, Belgium.
Fax: + 32 9264 94 96, Tel.: + 32 9264 92 73,
E-mail: [email protected]
Abbreviations: PtdCho, egg yolk phosphatidylcholine; PtdSer,
bovine brain phosphatidylserine; PamOle-PtdGro, 1-palmitoyl-2oleoylphosphatidyl-DL-glycerol; TFE, 2,2,2-trifluoroethanol; SUV,
small unilamellar vesicle.
(Received 2 January 2002, revised 19 April 2002,
accepted 25 April 2002)
Keywords: penetratin; homeoproteins; lipid vesicles; Trp
fluorescence; circular dichroism.
FEBS 2002
Penetratin: interaction with model membranes (Eur. J. Biochem. 269) 2919
a helicity is not required for internalization, as introduction
of one or three prolines in the sequence, did not affect
peptide internalization [12].
The aim of this study was to gain better insight into the
mode of interaction of the penetratin peptide with lipid
bilayers and to investigate the role of the Trp residues and
the lipids in this interaction. Lipid–peptide interactions can
conveniently be monitored through changes in Trp fluorescence emission properties of the peptide upon interaction
with model membranes [15–17]. For this purpose, two
penetratin analogues, in which Trp48 and Trp56 were
substituted by a phenylalanine, were synthesized. We
studied the interaction of the WT-penetratin and the two
W48F- and W56F-variants, with sonicated lipid vesicles,
consisting either of zwitterionic phosphatidylcholine
(PtdCho) or of a mixture of PtdCho with negatively
charged phosphatidylcholine (PtdSer). We further investigated the effect of cholesterol incorporation into lipid
bilayers containing negatively charged phospholipids.
Fluorescence lifetime measurements yielded the lifetimes
of the Trp residues in lipid-free and lipid-bound peptides.
Acrylamide and iodide quenching of Trp fluorescence,
enabled probing of the accessibility of the Trp residues.
Changes in the a helical conformation upon lipid binding
were investigated by CD measurements.
EXPERIMENTAL PROCEDURES
Materials
Egg PtdCho, bovine brain PtdSer, cholesterol and 2,2,2trifluoroethanol (TFE) were purchased from Sigma Chemical Co. The N-a-Fmoc amino acids and reagents for
peptide synthesis and sequencing were purchased from
Novabiochem and Sigma Chemical Co.
Peptide synthesis
Peptides were synthesized using the Fmoc-tBU strategy on
an AMS 422 peptide synthesizer (ABIMED, Germany) by
Synt:em (Nimes, France). The peptides were cleaved from
the resin by trifluoroacetic acid (90%) and purified by RPHPLC using various acetonitrile gradients in aqueous 0.1%
trifluoracetic acid. The purity was more than 95%. Peptide
molecular masses were determined by MALDI-TOF mass
spectrometry (Perspective Biosystem, UK). Peptides were
lyophilized and weighed, and 1 mgÆmL)1 solutions were
prepared in a 10 mM Tris/HCl buffer, pH 8.0, 0.15 M NaCl,
3 mM EDTA, 1 mM NaN3. Exact concentration was
determined by Phe quantification and by absorbance
measurements at 280 nm using molar extinction coefficients of 11 400 and 6000 M)1Æcm)1, respectively, for
WT-penetratin and for the two analogues.
SUVs were separated from multilamellar vesicles by gel
filtration on a Sepharose CL 4B column. The top fractions
of the SUV peak were pooled, concentrated and stored at
4 C. Phospholipid and cholesterol concentrations were
determined by enzymatic colorimetric assays (bioMérieux,
France; Boehringer, Germany); total lipid concentration
was determined by phosphorus analysis [18].
Fluorescence titration measurements
Peptide–phospholipid interactions were studied by monitoring the changes in the Trp fluorescence emission spectra of
the peptides upon addition of SUVs. Intrinsic fluorescence
of the Trp residues of the penetratin peptides was measured
before and after addition of different amounts of phospholipid vesicles to a 2 lM peptide solution. Trp fluorescence
was measured at 25 C in an Aminco Bowman Series 2
spectrofluorometer, equipped with a thermostatically controlled cuvette holder after mixing. Emission spectra were
recorded between 310 and 450 nm with an excitation
wavelength of 280 nm, at slit widths of 4 nm. Correction for
light scattering was carried out by subtracting the corresponding spectra of the SUVs.
Peptide–lipid binding was determined from the quenching
of the intrinsic Trp fluorescence intensity of the peptides,
upon addition of SUVs. The fluorescence intensity at
350 nm, expressed as the percentage of the fluorescence of
the lipid-free peptide was plotted vs. the added lipid
concentration. The data were analyzed using SIGMAPLOT
(SPSS Inc.).
The change in the fluorescence of the peptide can be
described by the following equation:
F ¼ ðF0 ½PF þ F1 ½PLÞ=ð½PF þ ½PLÞ
where F is the fluorescence intensity at a given added lipid
concentration, F0 the fluorescence intensity at the beginning
of the titration, F1 the fluorescence intensity at the end of the
titration, [PF] the concentration of free peptide and [PL] the
concentration of the peptide–lipid complex.
The concentration of PL can be obtained via the
definition of the dissociation (association) constant:
Kd ¼ 1=Ka ¼ ð½PF ½LF Þ=½PL
Lipids were dissolved in chloroform and dried as a thin film,
first under nitrogen followed by vacuum for 3 h. Lipid
suspension was prepared by vortex mixing in a 10 mM Tris/
HCl buffer, pH 8.0, 0.15 M NaCl, 3 mM EDTA, 1 mM
NaN3. The suspension was sonicated at 4 C, under
nitrogen for 30 min using a Sonics Material Vibra-CellTM
sonicator. Titanium debris was removed by centrifugation.
ð2Þ
with Kd dissociation constant, Ka association constant, [PF]
free peptide concentration, [LF] free lipid concentration and
[PL] peptide–lipid complex concentration.
For low affinity associations one can assume that after
lipid addition, the free lipid concentration [LF] equals the
total lipid concentration [Ltot]. Eqn (2) can be written as:
½PL ¼ Ka ½Ltot ½PF ð3Þ
Substitution of Eqn (3) in Eqn (1) leads to:
F ¼ ðF0 þ F1 Ka ½Ltot Þ=ð1 þ Ka ½Ltot Þ
Small unilamellar vesicle (SUV) preparation
ð1Þ
ð4Þ
Ka can thus be determined by plotting the measured
fluorescence intensity (F ) as a function of the total
concentration lipid added.
For high affinity associations the binding Eqn (2) was
rearranged to the following quadratic equation:
½PL2 ½PLð½Ptot þ ½Ltot =n þ Kd0 Þ þ ð½Ltot =nÞ½Ptot ¼ 0
ð5Þ
FEBS 2002
2920 B. Christiaens et al. (Eur. J. Biochem. 269)
The parameter n, representing the formal number of
phospholipid molecules that are involved in a binding site
for one peptide, is introduced in order to account for the
formal stoichiometry of binding (Kd¢ ¼ Kd/n). The solution
of this quadratic equation is thus given by:
½PL ¼ fS ðS2 4ð½Ltot =nÞ½Ptot Þ1=2 g=2
ð6Þ
with
S ¼ ½Ptot þ ½Ltot =n þ K0d
Substitution of Eqn (6) into Eqn (1) yields an equation of
F as a function of [Ptot] and [Ltot]. By plotting the
measured fluorescence intensity as a function of [Ltot], K¢d
and n can be determined. Kd is obtained by multiplying of
K¢d by n.
Circular dichroism measurements
CD measurements were carried out at room temperature on
a Jasco 710 spectropolarimeter between 184 and 260 nm in
quartz cells with a path length of 0.1 cm. Nine spectra were
recorded and averaged. The peptides were dissolved at a
concentration of 50 lgÆmL)1 in a 10 mM sodium phosphate
buffer and in 20, 50 and 100% TFE. CD spectra of the lipid
bound peptides were recorded after 1 h incubation at room
temperature of the peptides with the liposomes at a molar
ratio of 1 : 20 or 1 : 40. The spectra were corrected for
minor contributions of the SUVs by subtracting the
measured spectra of the lipids alone. The secondary
structure of the peptides was determined by curve fitting
to reference protein spectra using the CDNN program [24].
The helicity of the peptides was determined from the mean
residue ellipticity [Q] at 222 nm [25].
Fluorescence lifetime measurements
Fluorescence lifetimes were determined using an automated multifrequency phase fluorimeter. The instrument is
similar to that described by Lakowicz et al. [19], except
for the use of a high-gain photomultiplier (Hamamatsu
H5023) instead of a microchannel plate. The excitation
source consists of a mode-locked, titanium-doped sapphire laser (Tsunami; Spectra Physics) pumped by a
Beamlok 2080 Ar+-ion laser (2080; Spectra Physics) and
equipped with a pulse selector (Spectra Physics model
3980) to reduce the basic repetition frequency to
0.4 MHz. After frequency tripling (frequency tripler
Spectra Physics model GWU), the excitation wavelength
is 295 nm. The detection system was described previously
by Vos et al. [20]. In this way, fluorescence lifetime
measurements were performed by measuring the phase
shift of the modulated emission at 50 frequencies ranging
from 0.4 MHz to 1 GHz. N-Acetyl-L-typtophanamide
(in water at 21 C), with a lifetime of 3.12 ns, was used
as a reference fluorophore. The measured phase shifts (/)
at a modulation frequency (x) of the exciting light are
related to the fluorescence decay in the time domain as
described previously. Data analysis was performed as
described by De Beuckeleer et al. [21].
Quenching experiments
Peptide–lipid interactions are accompanied by changes in
the accessibility of the peptides to aqueous quenchers of
Trp fluorescence upon addition of SUVs. Acrylamide [22]
and iodide [23] quenching experiments were carried out
on a 2 lM peptide solution in the absence or presence of
SUVs by addition of aliquots of 2 M acrylamide solution
or a 2 M potassium iodide solution (containing 1 mM
Na2S2O3 to prevent I3– formation). The lipid–peptide
mixtures (molar ratio of 50 : 1) were incubated for 1 h at
room temperature prior to the measurements. The
excitation wavelength was set at 295 nm instead of
280 nm to reduce the absorbance by acrylamide and
iodide. Fluorescence intensities were measured at 350 nm
after addition of quencher at 25 C. The quenching
constants were obtained from the slope of the Stern–
Volmer plots of F0/F vs. [quencher], with F0 and F the
fluorescence intensities in the absence and presence of
quencher, respectively.
RESULTS
The sequences of the WT and variant peptides, with a
Trp fi Phe substitution at position 48 and 56 are
RQIKIWFQNRRMKWKK, RQIKIFFQNRRMKWKK
and RQIKIWFQNRRMKFKK, respectively. These substitutions did not affect the mean hydrophobicity, which
was )0.61, )0.58 and )0.58, respectively [26].
Binding of the penetratin peptides with lipid vesicles
Peptide binding to lipid vesicles was investigated by intrinsic
Trp fluorescence emission measurements. WT and variant
peptides were incubated with lipid vesicles consisting of
either pure PtdCho, PtdCho/PtdSer at different weight
ratios, or pure PtdSer (Table 1). 10% cholesterol was also
included in the PtdCho/PtdSer mixed vesicles.
The Trp fluorescence emission spectra of the WTpenetratin peptide, measured either in buffer or in the
presence of lipid vesicles are shown on Fig. 1. The maximal
emission wavelength (kmax) was 347 nm in buffer, as
previously reported for Trp in an aqueous environment [27].
Addition of PtdCho vesicles did not affect the shape of the
Trp fluorescence spectrum and only slightly decreased the
intensity (Fig. 1). On the contrary, addition of mixed
PtdCho/PtdSer vesicles containing 10 and 20% negatively
charged PtdSer, shifted kmax to lower wavelengths and
decreased significantly the intensity. This blue shift, indicative of a more hydrophobic environment of the Trp residues,
increased from 2 to 12 nm for PtdCho/PtdSer vesicles with
10 and 20% PtdSer, respectively. Incorporation of 10%
cholesterol in mixed PtdCho/PtdSer vesicles had a similar
effect on kmax. Incubation of the peptide with pure PtdSer
vesicles decreased kmax by 11 nm. Similar spectra were
obtained with the W48F- and W56F-penetratin peptides.
When incubated with mixed PtdCho/PtdSer vesicles with
20% PtdSer, kmax and Dk of the W56F variant differed more
from the WT peptide than the values of the W48F variant
(Table 1). kmax values for the lipid-bound peptides were
337.5 and 334.5 nm for the W48F- and W56F-penetratin,
respectively, compared to 336 nm for WT-penetratin; a
larger blue shift of 12.5 nm was measured for the W56F
variant compared to 9.5 nm for the W48F variant.
The corresponding titration curves obtained for the WT
peptide by plotting the percentage of initial fluorescence as a
FEBS 2002
Penetratin: interaction with model membranes (Eur. J. Biochem. 269) 2921
Table 1. Maximal Trp emission wavelength (kmax), dissociation constants (Kd) and binding stoichiometry (n, mole lipid/mole peptide) for the binding of
the penetratin peptides with different lipid vesicles. n is determined for high affinity binding curves. ND, not determined; chol, cholesterol.
SD ¼ 0.5 nm, number of experiments ¼ 3.
WT-penetratin
W48F-penetratin
W56F-penetratin
Lipid
Lipid ratio
(%, w/w)
kmax
(nm)
Kd
(lM)
n
kmax
(nm)
Kd
(lM)
n
kmax
(nm)
Kd
(lM)
n
Peptide
+ PtdCho
+ PtdCho/PtdSer
+ PtdCho/PtdSer
+ PtdSer
+ PtdCho/PtdSer/chol
–
100
90 : 10
80 : 20
100
70 : 20 : 10
347.0
347.0
345.0
336.0
336.5
339.0
–
230
137
0.67
0.37
44
–
ND
ND
13
11
ND
347.0
347.0
345.5
337.5
336.0
341.0
–
350
102
8.5
1.1
114
–
ND
ND
12
9
ND
347.0
347.0
345.0
334.5
337.0
338.5
–
320
103 ± 33
0.99 ± 0.30
0.63 ± 0.39
86 ± 17
–
ND
ND
17
5
ND
±
±
±
±
19
0.19
0.09
4.4
function of the lipid concentration are shown in Fig. 2.
Incubation of WT with pure PtdCho vesicles had little effect
on the Trp fluorescence intensity of the peptides (Fig. 2),
suggesting a low affinity of the peptide for this zwitterionic
phospholipid. Incorporation of negatively charged PtdSer
into the PtdCho vesicles significantly decreased the Trp
fluorescence intensity for the WT peptide. The Trp fluorescence intensity titration curves show saturable binding of
the WT-penetratin peptide to mixed PtdCho/PtdSer vesicles
containing 20% PtdSer or to pure PtdSer vesicles. Similar
titration curves were obtained for the W48F and W56F
penetratin peptides. Apparent dissociation constants, Kd,
were determined by curve fitting (Table 1). Interaction of
the peptides with PtdCho vesicles and with mixed PtdCho/
PtdSer vesicles containing 10% PtdSer was weak, as Kd
values were around 230–350 and 100–140 lM, respectively.
For the mixed PtdCho/PtdSer vesicles containing 20%
PtdSer and the 100% PtdSer vesicles, the dissociation
constant decreased by one or two orders of magnitude. The
Kd was around 1 lM for pure PtdSer vesicles. For lipid
vesicles containing 20% PtdSer, Kd values were highest for
the W48F variant (8.5 lM) while the WT- and W56Fpenetratin peptide had similar affinity (0.67 and 0.99 lM,
respectively). Incorporation of 10% cholesterol into the
PtdCho/PtdSer vesicles at a 70 : 20 : 10 (w/w/w) ratio
increased the dissociation constant 10- to 20-fold for each
peptide, compared to the corresponding 20% PtdSer
Fig. 1. Fluorescence emission spectra of WT-penetratin in buffer (j), in
the presence of PtdCho vesicles (h), of mixed PtdCho/PtdSer vesicles at
a 80 : 20, w/w ratio (s), and of PtdSer vesicles (m). Peptide and lipid
concentration were, respectively, 2 lM and 100 lM.
±
±
±
±
16
3.9
0.4
14
vesicles (Table 1). We also observed a decrease in the blue
shift upon addition of 10% cholesterol to the 20% PtdSer
vesicles. The stoichiometry (n) for lipid/peptide association
was calculated for the high affinity binding curves to mixed
PtdCho/PtdSer and PtdSer vesicles. It varied between 5 and
17 mol lipid per mol peptide, and was similar for the three
peptides (Table 1).
The effect of salt concentration on the binding affinity of
WT-penetratin to PtdCho/PtdSer vesicles containing 20%
PtdSer was investigated. The dissociation constant increased
by one to two orders of magnitude in buffers containing,
respectively, 0.5 and 1 M NaCl. The accompanying blue
shift was limited to 1–3 nm at high salt concentration (data
not shown), suggesting a significant role for electrostatic
interactions in lipid–peptide binding.
Fluorescence lifetimes
The fluorescence decay parameters of the Trp residue(s) for
the three penetratin peptides were determined at pH 8, in
Fig. 2. Fluorescence titration curves of WT-penetratin with lipid vesicles
consisting of PtdCho (h), PtdCho/PtdSer (90 : 10, w/w) (j), PtdCho/
PtdSer (80 : 20, w/w) (s), PtdSer (m) and PtdCho/PtdSer/chol
(70 : 20 : 10, w/w/w) (d). The solid lines represents the best fits to the
binding curves.
FEBS 2002
2922 B. Christiaens et al. (Eur. J. Biochem. 269)
the absence and presence of PtdCho/PtdSer (20 : 80, w/w)
vesicles. The fluorescence curves could be optimally fitted
using a triple-exponential decay, even at relatively high v2R
values. The amplitudes and lifetimes, together with the
calculated mean lifetime Æsæ for the Trp residue(s) of the
three peptides, are summarized in Table 2. Mean lifetimes
of, respectively, 2.25, 2.06 and 2.45 ns were obtained for the
WT-, W48F- and W56F-penetratin in buffer. Upon addition of the mixed PtdCho/PtdSer vesicles containing 80%
PtdSer at a molar lipid/peptide ratio of 25 : 1, the shortest
lifetime components s1 and s2 decreased strongly, while the
longest lifetime component s3 of the Trp residue in
the W48F-penetratin increased slightly. The amplitude of
the longest Trp lifetime component decreased 10-fold
whereas the amplitude of the shortest lifetime component
increased threefold for all three peptides. This resulted in,
respectively, a sevenfold and a fourfold to fivefold decrease
of the mean lifetime of the Trp residue(s) in the W56F- and
WT- or W48F-penetratin. The decrease of the mean Trp
lifetime for the three peptides might account for the decrease
of the Trp fluorescence intensity upon binding to negatively
charged lipid vesicles. Increasing the amount of added lipid
to a 50 : 1 molar ratio did not further decrease the mean
lifetimes.
The lifetimes of the WT-, W48F- and the W56Fpenetratin were further measured in TFE, a decrease of
the mean lifetime was observed for all peptides (Table 2).
acrylamide quenching, while addition of mixed PtdCho/
PtdSer or of pure PtdSer vesicles significantly decreased the
Ksv values for the three peptides. A twofold decrease of Ksv
was observed for PtdCho/PtdSer vesicles containing 10%
PtdSer up to a sixfold to sevenfold decrease for pure PtdSer
vesicles. Incorporation of cholesterol into PtdCho/PtdSer
vesicles (PtdCho/PtdSer/cholesterol 70 : 20 : 10, w/w/w)
decreased the acrylamide quenching to a similar extent as
for the corresponding PtdCho/PtdSer (80 : 20, w/w)
vesicles. Similar results were obtained for iodide quenching
(Fig. 3B, Table 3). For the lipid-free peptides, we calculated
the average rate constant for collisional quenching, from the
Stern–Volmer constant using the average lifetime
(kq ¼ KSV/hsi). For acrylamide quenching, kq values
were, respectively, 6.2, 6.1 and 5.9 · 109 M)1Æs)1 for WT-,
W48F- and W56F-penetratin. These values are similar to
the kq value of 6.6 · 109 M)1Æs)1 obtained for free Trp. For
iodide quenching, kq values amount to, respectively, 4.9,
5.6 and 4.6 · 109 M)1Æs)1 for WT-, W48F- and W56Fpenetratin. These values are slightly higher than the kq
value measured for free Trp, which amounted up to
3.6 · 109 M)1Æs)1. Upon addition to the peptides of negatively charged PtdCho/PtdSer vesicles, containing 80%
PtdSer, kq values decreased threefold and fivefold for
acrylamide and iodide quenching, respectively, indicating
shielding of the Trp residues against collision with the
quenchers.
Acrylamide and iodide quenching of lipid-free
and lipid-bound penetratin peptides
Secondary structure of the lipid-free
and lipid-bound peptides
Fluorescence quenching by acrylamide and iodide was used
to monitor the Trp environment of the lipid-free and lipidbound peptides. It was compared to the quenching of free
Trp in a Tris/HCl buffer and in the presence of lipids. Stern–
Volmer plots of acrylamide (A) and iodide (B) quenching
are shown in Fig. 3 for WT-penetratin in buffer and in the
presence of PtdCho, mixed PtdCho/PtdSer vesicles and
PtdSer vesicles. The calculated Stern–Volmer constants
(Ksv) are summarized in Table 3. Acrylamide quenching
(Fig. 3A) was efficient in the Tris/HCl buffer, as Ksv for the
three peptides amounted up to 70% of that of Trp.
Incubation with neutral PtdCho vesicles had no effect on
The CD spectra of WT-penetratin in phosphate buffer, after
addition of TFE and upon incubation with neutral and
anionic vesicles are shown in Fig. 4. The percentages of
a helical structure are listed in Table 4. The CD spectrum
for the WT peptide in the phosphate buffer is indicative of a
predominantly random structure with only a small amount
of helix. In the presence of 50% TFE, the shape of the
spectrum is that of an a helical structure, with the characteristic minima at 208 and 222 nm. The percentage of a helix
increased from 10% in buffer to 66–72% in 100% TFE.
An increase in a helical structure was also observed upon
incubation with the anionic mixed PtdCho/PtdSer vesicles
Table 2. Trp fluorescence lifetimes (s, ns) and amplitudes (a) at 350 nm of the penetratin peptides in the absence and presence of negatively charged
PtdCho/PtdSer vesicles (20 : 80, w/w). Æsæ is calculated as Æsæ ¼ Siaisi.
Peptide
Lipid/peptide
molar ratio
s1
s2
a1
s3
a2
a3
Æsæ
v2R
WT-penetratin
– (buffer)
– (TFE)
25 : 1
50 : 1
0.48
0.36
0.14
0.15
±
±
±
±
0.07
0.10
0.01
0.01
2.15
1.53
1.09
1.12
±
±
±
±
0.26
0.18
0.06
0.07
4.06
4.28
3.43
3.46
±
±
±
±
0.22
0.32
0.13
0.18
0.28
0.36
0.66
0.72
±
±
±
±
0.02
0.05
0.02
0.02
0.44
0.50
0.26
0.22
±
±
±
±
0.06
0.03
0.01
0.01
0.28
0.14
0.081
0.060
±
±
±
±
0.04
0.01
0.003
0.002
2.25
1.50
0.65
0.56
1.0
3.8
3.5
2.9
W48F-penetratin
– (buffer)
– (TFE)
25 : 1
50 : 1
0.42
0.36
0.10
0.14
±
±
±
±
0.09
0.06
0.07
0.05
1.90
1.33
1.23
1.40
±
±
±
±
0.37
0.10
0.23
0.14
3.40
4.33
3.63
4.06
±
±
±
±
0.44
0.32
0.15
0.40
0.25
0.38
0.82
0.78
±
±
±
±
0.03
0.04
0.01
0.01
0.40
0.55
0.13
0.18
±
±
±
±
0.08
0.03
0.04
0.01
0.35
0.062
0.04
0.043
±
±
±
±
0.08
0.005
0.01
0.003
2.06
1.15
0.40
0.53
1.7
3.5
3.3
6.6
W56F-penetratin
– (buffer)
– (TFE)
25 : 1
50 : 1
0.52
0.39
0.10
0.12
±
±
±
±
0.06
0.08
0.01
0.02
1.99
1.76
0.85
1.04
±
±
±
±
0.28
0.17
0.21
0.25
3.99
4.48
2.60
3.29
±
±
±
±
0.16
0.36
0.13
0.27
0.28
0.34
0.77
0.78
±
±
±
±
0.03
0.04
0.01
0.02
0.29
0.51
0.18
0.18
±
±
±
±
0.03
0.02
0.01
0.01
0.43
0.15
0.046
0.041
±
±
±
±
0.06
0.01
0.002
0.002
2.45
1.70
0.35
0.42
1.1
3.1
2.8
6.2
FEBS 2002
Penetratin: interaction with model membranes (Eur. J. Biochem. 269) 2923
Fig. 3. Stern–Volmer plots for the Trp fluorescence quenching of
WT-penetratin in buffer (j), and in the presence of lipid vesicles consisting of PtdCho (h), PtdCho/PtdSer (80 : 20 w/w) (s), PtdSer (m)
and PtdCho/PtdSer/chol (70 : 20 : 10, w/w/w) (·) by the aqueous
quenchers acrylamide (A) and iodide (B).
(Fig. 4). Addition of PtdCho vesicles to the WT peptide did
not significantly affect the CD spectrum of the peptide
compared to that measured in buffer. Similar results were
obtained for the W48F-and W56F-penetratin peptides
(Table 4).
DISCUSSION
This study was aimed at getting better insight in the
interaction of penetratin peptides with lipids, and especially
in the contribution of the Trp residues and of negatively
charged lipids. We therefore investigated the fluorescence
properties of the W48 and W56 residues, either in combi-
nation in the WT-penetratin, or separately in the W48Fand the W56F-penetratin single variants, and the effect of
incorporating negatively charged PtdSer and cholesterol in
the PtdCho vesicles.
In lipid-free penetratin peptides, the two Trp residues are
highly exposed to the solvent, and the maximal emission
wavelength of 347 nm suggests that WT and penetratin
variants are not significantly aggregated in solution. This
was confirmed by the extent of acrylamide quenching,
which is relatively high compared to other peptides
[23,28,29]. In buffer, the peptides and free Trp were
quenched by iodide with similar efficiency. A more efficient
iodide quenching was also reflected in kq values higher than
for free Trp. This might be due to the electrostatic
interaction between positively charged residues of the
peptides and negatively iodide ions.
Addition of neutral lipid vesicles to the peptides induced
no blue shift of kmax and had little effect on acrylamide and
iodide quenching. This suggests only a weak interaction
between the peptides and PtdCho vesicles, and a limited
insertion of the peptides into the hydrophobic core of
the lipid bilayer. These weak interactions are reflected in the
high apparent dissociation constants, calculated from the
fluorescence titration curves. In contrast, the three peptides
strongly interacted with negatively charged lipid vesicles
containing 20% (w/w) or more PtdSer, yielding a blue shift
of 10–13 nm. The blue shift was more pronounced for the
W56F- than for the W48F-penetratin with the mixed
PtdCho/PtdSer vesicles containing 20% PtdSer, suggesting
a deeper insertion of Trp48 into the lipid bilayer. The lower
affinity of the W48F-penetratin variant for lipids, suggested
by higher Kd values than for the W56F-penetratin variant
further supports the tighter association of Trp48 with lipids.
The interaction with mixed PtdCho/PtdSer or PtdSer
vesicles decreased Trp quenching by acrylamide and iodide,
as illustrated by the low Ksv values and by the lower collision
quenching constants. Shielding from iodide quenching by
vesicles containing 20% PtdSer or more, was larger for the
W56F- than for the W48F-penetratin variant, in agreement
with the deeper insertion of Trp48 into the lipids.
According to Lindberg & Graslund, the C-terminus of
WT-penetratin inserts deeply into SDS micelles, whereas
residues 48–50 are closer to the micellar surface [42]. Size
differences between the PtdCho/PtdSer vesicles used in our
study, and the smaller SDS micelles with high curvature and
full negative charge used by Lindberg & Graslund, might
account for the discrepancy between the data. The
interaction and orientation of the peptides might indeed
be dependent upon the model membrane system used. Drin
et al. [30] further showed a higher decrease of the binding
affinity of 7-nitrobenz-2-oxo-1,3-diazol-4-yl-penetratin peptides for negatively charged 1-palmitoyl-2-oleoylphosphatidyl-DL-choline/1-palmitoyl-2-oleoylphosphatidyl-DL-glycerol (PamOle-PtdGro) vesicles, for the W48A compared to
the W56A variant. Deletion of Trp48 and Phe49 in the third
helix of antennapedia completely impaired the internalization of the Antp-HD 48S peptide [4]. A penetratin variant,
with two Trp fi Phe substitutions was internalized to a
small extent or not at all [5]. Joliot et al. further showed that
the engrailed homeoprotein, with an Ile residue at position
56 of its homeodomain, was efficiently internalized [31]. The
functional importance of Trp48 is further supported by its
higher degree of conservation (> 95%) among the primary
FEBS 2002
2924 B. Christiaens et al. (Eur. J. Biochem. 269)
Table 3. Stern–Volmer constants Ksv for fluorescence emission quenching of pure Trp and of Trp residues in penetratin peptides before and after
incubation with lipid vesicles. Chol, cholesterol; ND, not determined.
Acrylamide quenching
Iodide quenching
Stern–Volmer constant Ksv (M)1)
Stern–Volmer constant Ksv (M)1)
Lipid
Lipid ratio
(%, w/w)
Trp
WTpenetratin
W48Fpenetratin
W56Fpenetratin
Trp
WTpenetratin
W48Fpenetratin
W56Fpenetratin
–
+
+
+
+
+
100
90 : 10
80 : 20
100
70 : 20 : 10
20.7
ND
ND
ND
ND
ND
14.0
12.0
5.8
3.0
3.3
3.1
12.6
12.7
7.1
2.9
1.9
2.5
14.4
11.1
7.2
4.0
1.8
2.7
11.3
10.4
ND
11.5
11.1
ND
11.1
13.0
ND
2.3
1.1
2.2
11.5
12.0
ND
2.7
2.1
2.8
11.3
10.7
ND
2.2
1.2
2.2
PtdCho
PtdCho/PtdSer
PtdCho/PtdSer
PtdSer
PtdCho/PtdSer/chol
Fig. 4. CD spectra of WT-penetratin in a phosphate buffer, pH 7.4 (j),
in 50%TFE (d), in the presence of lipid vesicles consisting of PtdCho
(h) and PtdCho/PtdSer (80 : 20, w/w) (s). Peptide concentration was
22 lM, lipid concentration was 880 lM.
sequences of 346 different homeodomains, compared to
only 32% conservation for Trp56 [1].
Significant binding of the three peptides was only
observed to negatively charged vesicles, suggesting higher
contribution of electrostatic compared to hydrophobic
interactions, as expected for basic peptides with a pI of
12.6. This is further supported by the 10- to 100-fold
increase of the apparent dissociation constants at high salt
concentrations. The weak binding observed to mixed
PtdCho/PtdSer 90 : 10 vesicles might be due to the low
number of negatively charged lipids in the outer bilayer of
the vesicles, as the apparent dissociation constant
decreased 10- to 100-fold when PtdSer content increased
from 10 to 100%. Similar results were reported for the
binding of the magainin 2 cationic peptide to PtdCho/
PamOle-PtdGro vesicles [32]. The apparent binding constant of magainin 2 increased 10-fold, when the PamOlePtdGro content increased from 25 to 100%. Addition of
cholesterol to PtdCho/PtdSer 80 : 20 vesicles, significantly
decreases both the binding affinity and the blue shift,
probably due to an increased rigidity of the unsaturated
phospholipid acyl chains in the cholesterol-containing
vesicles. In spite of the decreased affinity of the penetratin
peptides for cholesterol-containing vesicles, the remaining
blue shift was still significant. The similar acrylamide and
iodide quenching in PtdCho/PtdSer and PtdCho/PtdSer/
cholesterol vesicles further support an insertion of the
peptides into the core of the bilayer. Similar effects were
reported for the interaction of magainin antibacterial
peptides to PtdCho/cholesterol vesicles [33]. Calcein
leakage induced by the nisin cationic peptide from
1-palmitoyl-2-oleoylphosphatidyl-DL-choline vesicles was
further inhibited by formation of liquid-ordered lipid
phases in the presence of cholesterol [34].
Insertion of a Trp residue into a more hydrophobic
environment is usually characterized by a fluorescence blue
shift and by an increase in the fluorescence quantum yield
[35]. However, the blue shift for the binding of penetratin
Table 4. Percentages of a helical structure of the lipid-free and lipid-bound penetratin peptides.
WT-penetratin
Buffer
20% TFE
50% TFE
100% TFE
+ PtdCho
+ PtdCho/PtdSer (80 : 20, w/w)
+ PtdCho/PtdSer (80 : 20, w/w)
Lipid/peptide
molar ratio
CDNN
–
–
–
–
20 : 1
20 : 1
40 : 1
11
32
62
69
14
29
42
a
W48F-penetratin
[Q]222b
CDNN
8
26
55
66
13
24
35
8
28
65
72
17
21
29
a
W56F-penetratin
[Q]222b
CDNN
6
25
59
68
10
16
25
10
35
65
71
11
26
43
a
Helical content as calculated by curve fitting to reference protein spectra using the CDNN program [24].
from [Q]222 according to Chen et al. [25].
b
a
[Q]222b
9
29
61
67
13
22
34
Helical content as calculated
FEBS 2002
Penetratin: interaction with model membranes (Eur. J. Biochem. 269) 2925
peptides to PtdCho/PtdSer vesicles was accompanied by at
least a twofold decrease of the fluorescence intensity and a
decrease of the mean Trp lifetime, in contrast with the
behaviour of other peptides [17]. The three lifetimes of
penetratins are attributed to the classical three rotamers of
chi1 (Ca–Cb). The average lifetime of the lipid-free
WT-penetratin was calculated from the average lifetimes
of the individual Trp residues, assuming pure additivity [20].
This indicates that there are no significant interactions
between Trp48 and Trp56, either directly by energy transfer,
or indirectly by conformational effects. The fluorescence
lifetimes calculated for the lipid-free penetratin peptides
agree with the lifetimes and amplitude fractions reported by
Clayton & Sawyer [36] for five variants of an amphipathic
peptide, where the single Trp was moved along the
sequence. Interaction of these peptides with lipid vesicles is
accompanied by an increase of the a helix conformation, a
disappearance of the short fluorescence lifetime, an increase
of the two other lifetimes and of the mean average lifetime.
In contrast, the amplitude of the long lifetime component is
reduced to a few percent in penetratin, as are all lifetimes.
Decrease of the mean Trp lifetimes in WT-, W48F- and
W56F-penetratin variants measured in 100% TFE, was less
than twofold compared to a fourfold to sevenfold decrease
upon interaction with negatively charged lipid vesicles. The
decrease of the mean Trp fluorescence lifetime of the 3Pro
penetratin variant (RQPKIWFPNRRMPWKK) measured
in 100% TFE was also around twofold (data not shown)
although this peptide did not become a helical in TFE. This
suggests that the conformational changes from random to
a helical structure do not account for the observed Trp
quenching. Other parameters, such as the interaction with
PtdSer headgroups and/or the quenching of the Trp indole
moiety by arginine and lysine side chains in penetratin
peptides might account for this effect. Titrations of the
WT-penetratin with PtdCho/PtdGro (80 : 20) and PtdCho/
phosphatidic acid (80 : 20) vesicles induced only a blue shift
of 10 nm but did not affect the fluorescence intensity (data
not shown), suggesting a specific contribution of the PtdSer
headgroup to fluorescence quenching. Peptide conformational changes accompanying binding of the penetratin
peptide to negatively charged vesicles, might decrease the
distance between one or more lysines or arginines and the
Trp48 and 56 residues. Chen & Barkley [37] showed that the
side chains of eight amino acids, including lysine, can
quench Trp fluorescence. Similar quenching of Trp158 by
Lys165 in the extracellular domain of human tissue factor
was reported by Hasselbacher et al. [38]. Clark et al. further
showed that Trp109 in the cellular retinoic acid-binding
protein I is fluorescence-silent due to its interaction with the
guanidino group of Arg111 [39].
WT and penetratin variants have a propensity to become
a helical in 100% TFE, an a helix inducing solvent [40,41],
and upon binding to negatively charged SUVs. Berlose
et al. showed that WT-penetratin became a helical in 30%
hexafluoroisopropanol, in perfluoro-tert-butanol and in the
presence of SDS micelles [14]. Although the 3Pro variant
had similar affinity to WT-penetratin for PtdCho/PtdSer
(80 : 20, w/w) vesicles, it did not become a helical upon lipid
association or when solubilized in TFE (data not shown).
a Helix formation thus does not seem to be a prerequisite
for lipid binding or for cell internalization, as shown by
Derossi et al. [12].
In summary, our data suggest a mode of the penetratin
peptide interaction with negatively charged PtdCho/PtdSer
vesicles, where Trp48 is inserted more deeply into the lipid
bilayer compared to Trp56. Peptide–lipid association is
primarily due to electrostatic interactions between the
positive charged Arg and Lys residues with the PtdSer
headgroup, as suggested by fluorescence intensity and
lifetime data. Penetratin translocation across the cell
membrane is thus dependent upon its interaction with
negatively charged lipids, which stabilizes the peptide
a helical conformation.
REFERENCES
1. Gehring, W.J., Affolter, M. & Burglin, T. (1994) Homeodomain
proteins. Annu. Rev. Biochem. 63, 487–526.
2. Gehring, W.J., Qian, Y.Q., Billeter, M., Furukubo-Tokunaga, K.,
Schier, A.F., Resendez-Perez, D., Affolter, M., Otting, G. &
Wuthrich, K. (1994) Homeodomain-DNA recognition. Cell 78,
211–223.
3. Joliot, A.H., Triller, A., Volovitch, M., Pernelle, C. & Prochiantz,
A. (1991) alpha-2,8-Polysialic acid is the neuronal surface receptor
of antennapedia homeobox peptide. New Biol. 3, 1121–1134.
4. Le Roux, I., Joliot, A.H., Bloch-Gallego, E., Prochiantz, A. &
Volovitch, M. (1993) Neurotrophic activity of the antennapedia
homeodomain depends on its specific DNA-binding properties.
Proc. Natl Acad. Sci. USA 90, 9120–9124.
5. Derossi, D., Joliot, A.H., Chassaing, G. & Prochiantz, A. (1994)
The third helix of the antennapedia homeodomain translocates
through biological membranes. J. Biol. Chem. 269, 10444–10450.
6. Prochiantz, A. (1998) Peptide nucleic acid smugglers. Nat. Biotechnol. 16, 819–820.
7. Derossi, D., Chassaing, G. & Prochiantz, A. (1998) Trojan peptides: the penetratin system for intracellular delivery. Trends. Cell
Biol. 8, 84–87.
8. Prochiantz, A. (1996) Getting hydrophilic compounds into cells:
lessons from homeopeptides. Curr. Opin. Neurobiol. 6, 629–634.
9. Theodore, L., Derossi, D., Chassaing, G., Llirbat, B., Kubes, M.,
Jordan, P., Chneiweiss, H., Godement, P. & Prochiantz, A. (1995)
Intraneuronal delivery of protein kinase C pseudosubstrate leads
to growth cone collapse. J. Neurosci. 15, 7158–7167.
10. Troy, C.M., Derossi, D., Prochiantz, A., Greene, L.A. &
Shelanski, M.L. (1996) Downregulation of Cu/Zn superoxide
dismutase leads to cell death via the nitric oxide-peroxynitrite
pathway. J. Neurosci. 16, 253–261.
11. Pooga, M., Soomets, U., Hallbrink, M., Valkna, A., Saar, K.,
Rezaei, K., Kahl, U., Hao, J.X., Xu, X.J., Wiesenfeld-Hallin, Z.,
Hokfelt, T., Bartfai, T. & Langel, U. (1998) Cell penetrating PNA
constructs regulate galanin receptor levels and modify pain
transmission in vivo. Nat. Biotechnol. 16, 857–861.
12. Derossi, D., Calvet, S., Trembleau, A., Brunissen, A., Chassaing,
G. & Prochiantz, A. (1996) Cell internalization of the third helix of
the antennapedia homeodomain is receptor-independent. J. Biol.
Chem. 271, 18188–18193.
13. de Kruijff, B., Cullis, P.R., Verkleij, A.J., Hope, M.J., van Echteld,
C.J.A., Taraschi, T.F., van Hoogevest, P., Killian, J.A., Rietveld,
A.G. & van der Steen, A.T.M. (1985) Progress in Protein–Lipid
Interactions. pp. 89–142. Elsevier. Science Publishers, B.V.,
Amsterdam.
14. Berlose, J.P., Convert, O., Derossi, D., Brunissen, A. & Chassaing,
G. (1996) Conformational and associative behaviours of the third
helix of antennapedia homeodomain in membrane-mimetic
environments. Eur. J. Biochem. 242, 372–386.
15. de Kroon, A.I., Soekarjo, M.W., De Gier, J. & de Kruijff, B.
(1990) The role of charge and hydrophobicity in peptide–lipid
interaction: a comparative study based on tryptophan fluorescence
2926 B. Christiaens et al. (Eur. J. Biochem. 269)
16.
17.
18.
19.
20.
21.
22.
23.
24.
25.
26.
27.
28.
29.
measurements combined with the use of aqueous and hydrophobic quenchers. Biochemistry 29, 8229–8240.
Surewicz, W.K. & Epand, R.M. (1985) Role of peptide structure
in lipid–peptide interactions: high-sensitivity differential scanning
calorimetry and electron spin resonance studies of the structural
properties of dimyristoylphosphatidylcholine membranes interacting with pentagastrin-related pentapeptides. Biochemistry 24,
3135–3144.
Jain, M.K., Rogers, J., Simpson, L. & Gierasch, L.M. (1985)
Effect of tryptophan derivatives on the phase properties of
bilayers. Biochim. Biophys. Acta 816, 153–162.
Bartlett, G.R. (1958) Phosphorus assay in column chromatography. J.Biol. Chem. 234, 466–468.
Lakowicz, J.R., Laczko, G. & Gryczinski, I. (1985) 2-GHz frequency-domain fluorometer. Rev. Sci. Instrum. 57, 2499–2506.
Vos, R., Engelborghs, Y., Izard, J. & Baty, D. (1995) Fluorescence
study of the three tryptophan residues of the pore-forming domain
of colicin A using multifrequency phase fluorometry. Biochemistry
34, 1734–1743.
De Beuckeleer, K., Volckaert, G. & Engelborghs, Y. (1999) Time
resolved fluorescence and phosphorescence properties of the
individual tryptophan residues of barnase: evidence for protein–
protein interactions. Proteins 36, 42–53.
Eftink, M.R. & Ghiron, A. (1976) Exposure of tryptophanyl
residues in proteins. Quantitative determination by fluorescence
quenching studies. Biochemistry 15, 672–680.
Lehrer, S.S. (1971) Solute perturbation of protein fluorescence. the
quenching of the tryptophyl fluorescence of model compounds
and of lysozyme by iodide ion. Biochemistry 10, 3254–3263.
Bohm, G., Muhr, R. & Jaenicke, R. (1992) Quantitative analysis
of protein far UV circular dichroism spectra by neural networks.
Protein Eng. 5, 191–195.
Chen, Y.H., Yang, J.T. & Martinez, H.M. (1972) Determination
of the secondary structures of proteins by circular dichroism and
optical rotatory dispersion. Biochemistry 11, 4120–4131.
Eisenberg, D., Weiss, R.M. & Terwilliger, T.C. (1984) The
hydrophobic moment detects periodicity in protein hydrophobicity. Proc. Natl Acad. Sci. USA 81, 140–144.
Burstein, E.A., Vedenkina, N.S. & Ivkova, M.N. (1974) Fluorescence and the location of tryptophan residues in protein molecules.
Photochem. Photobiol. 18, 263–279.
Eftink, M.R. & Ghiron, C.A. (1977) Exposure of tryptophanyl
residues and protein dynamics. Biochemistry 16, 5546–5551.
Killian, J.A., Keller, R.C., Struyve, M., de Kroon, A.I.,
Tommassen, J. & de Kruijff, B. (1990) Tryptophan fluorescence
study on the interaction of the signal peptide of the Escherichia coli
outer membrane protein PhoE with model membranes.
Biochemistry 29, 8131–8137.
FEBS 2002
30. Drin, G., Mazel, M., Clair, P., Mathieu, D., Kaczorek, M. &
Temsamani, J. (2001) Physico-chemical requirements for cellular
uptake of pAntp peptide Role of lipid-binding affinity. Eur. J.
Biochem. 268, 1304–1314.
31. Joliot, A., Maizel, A., Rosenberg, D., Trembleau, A., Dupas, S.,
Volovitch, M. & Prochiantz, A. (1998) Identification of a signal
sequence necessary for the unconventional secretion of Engrailed
homeoprotein. Curr. Biol. 8, 856–863.
32. Wieprecht, T., Dathe, M., Schumann, M., Krause, E., Beyermann, M. & Bienert, M. (1996) Conformational and functional
study of magainin 2 in model membrane environments using the
new approach of systematic double-D-amino acid replacement.
Biochemistry 35, 10844–10853.
33. Wieprecht, T., Beyermann, M. & Seelig, J. (1999) Binding of
antibacterial magainin peptides to electrically neutral membranes:
thermodynamics and structure. Biochemistry 38, 10377–10387.
34. El Jastimi, R., Edwards, K. & Lafleur, M. (1999) Characterization of permeability and morphological perturbations induced
by nisin on phosphatidylcholine membranes. Biophys. J. 77,
842–852.
35. Udenfried, S. (1969) Fluorescence Assay in Biology and Medicine.
Academic Press, New York.
36. Clayton, A.H. & Sawyer, W.H. (1999) Tryptophan rotamer distributions in amphipathic peptides at a lipid surface. Biophys. J.
76, 3235–3242.
37. Chen, Y. & Barkley, M.D. (1998) Toward understanding tryptophan fluorescence in proteins. Biochemistry 37, 9976–9982.
38. Hasselbacher, C.A., Rusinova, E., Waxman, E., Rusinova, R.,
Kohanski, R.A., Lam, W., Du Guha, A.J., Lin, T.C. & Polikarpov, I. (1995) Environments of the four tryptophans in the
extracellular domain of human tissue factor: comparison of results
from absorption and fluorescence difference spectra of tryptophan
replacement mutants with the crystal structure of the wild-type
protein. Biophys. J. 69, 20–29.
39. Clark, P.L., Liu, Z.P., Zhang, J. & Gierasch, L.M. (1996) Intrinsic
tryptophans of CRABPI as probes of structure and folding.
Protein Sci. 5, 1108–1117.
40. Bruch, M.D. & Gierasch, L.M. (1990) Comparison of helix stability in wild-type and mutant LamB signal sequences. J. Biol.
Chem. 265, 3851–3858.
41. Lehrman, S.R., Tuls, J.L. & Lund, M. (1990) Peptide alphahelicity in aqueous trifluoroethanol: correlations with
predicted alpha-helicity and the secondary structure of the corresponding regions of bovine growth hormone. Biochemistry 29,
5590–5596.
42. Lindberg, M. & Gräslund, A. (2001) The position of the cell
penetrating peptide penetratin in SDS micelles determined by
NMR. FEBS Lett. 497, 39–44.
Eur. J. Biochem. 271, 1187–1197 (2004) FEBS 2004
doi:10.1111/j.1432-1033.2004.04022.x
Membrane interaction and cellular internalization of penetratin
peptides
Bart Christiaens1, Johan Grooten2, Michael Reusens1, Alain Joliot4, Marc Goethals1,3,
Joël Vandekerckhove1,3, Alain Prochiantz4 and Maryvonne Rosseneu1
1
Department of Biochemistry of the Ghent University, 2Department of Molecular Biology and 3Department of Medical Protein
Research of the Flanders Interuniversity Institute for Biotechnology, Ghent, Belgium; 4Ecole Normale Supe´rieure, Paris, France
Penetratin is a 16-residue peptide [RQIKIWFQNRRM
KWKK(43–58)] derived from the Antennapedia homeodomain, which is used as a vector for cellular internalization
of hydrophilic molecules. In order to unravel the membrane
translocation mechanism, we synthesized new penetratin
variants. The contribution of the positively charged residues
was studied by double substitutions of Lys and/or Arg residues to Ala, while the specific contribution of Trp48 and
Trp56 was studied by individual substitution of these residues to Phe. Trp fluorescence titrations demonstrated the
importance of the positively charged residues for the initial
electrostatic interaction of the peptide with negatively
charged vesicles. In contrast, none of the Trp residues
seemed critical for this initial interaction. Trp fluorescence
quenching experiments showed that penetratin lies close to
the water–lipid interface in a tilted orientation, while circular
dichroism indicated that lipid binding increased the a-helical
structure of the peptides. The R53A/K57A and R52A/
K55A substitutions increased calcein leakage and decreased
vesicle aggregation compared to wild-type penetratin. These
variants insert deeper into the lipid bilayer, due to an
increased hydrophobic environment of Trp56. The W48F
and W56F substitutions had a minor effect on membrane
insertion and destabilization. Cellular internalization of the
R53A/K57A, R52A/K55A and K46A/K57A variants by
MDCK cells was similar to wild-type penetratin, as shown
by flow cytometry. Moreover, residue Trp48 specifically
contributed to endocytosis-independent internalization by
MDCK cells, as demonstrated by the lower uptake of the
W48F variant compared to wild-type penetratin and to
the W56F variant. None of the penetratin variants was
haemolytic or cytotoxic.
Homeoproteins are a class of well-conserved transcription
factors, involved in multiple morphological processes [1,2].
The 60-residue DNA-binding homeodomain of the Drosophila Antennapedia homeoprotein was shown to internalize
into cells via a receptor-independent mechanism [3–5]. This
homeodomain consists of three helices and a loop separating helix 2 and 3 [2]. Mutagenesis experiments demonstrated that the third helix drives the homeodomain
internalization [6]. The short 16-residue penetratin peptide, corresponding to residues RQIKIWFQNRRMK
WKK(43–58) of helix 3, is able to translocate through the
plasma membrane to the cytosol and nucleus of living cells,
both at 37 C and 4 C.
Translocation of the penetratin peptide occurs even when
it is coupled to hydrophilic molecules (e.g. phosphopeptides,
oligonucleotides, peptidic nucleic acids, drugs, etc.) [7–16].
The penetratin peptide is therefore considered as a member
of the so-called Trojan peptides or cell-penetrating peptides
(CPP) that are water-soluble peptides with a low lytic
activity that can be used as vectors for cellular internalization of hydrophilic biomolecules and drugs [17,18]. Despite
its broad application field, the internalization mechanism of
the penetratin peptide has not been unravelled yet. A chiral
receptor or a transporter protein is not required, as retroenantio and retro-inverso variants of penetratin are also
internalized [19]. Presumably, cellular internalization of the
penetratin peptide occurs via a direct interaction with the
cell membrane [7,9].
Previous studies showed that penetratin strongly interacts
with negatively charged phospholipids [16,20–25]. Such
interaction affects the secondary structure of the penetratin
peptide [20,21,23–29]. Although Drin et al. carried out an
Ala-scan mapping of the penetratin peptide, they did not
succeed in identifying positively charged residues that are
of critical importance for the membrane interaction of the
peptide [22]. To clarify the contribution of the positively
charged residues to the interaction with model membranes
and to the endocytosis-independent cellular internalization
Correspondence to B. Christiaens, Laboratory Lipoprotein Chemistry,
Department Biochemistry, Ghent University, Hospitaalstraat 13,
B-9000 Gent, Belgium. Fax: + 32 9264 94 96,
Tel.: + 32 9264 92 73, E-mail: [email protected]
Abbreviations: CD, circular dichroism; CPP, cell-penetrating peptides;
DLS, dynamic light scattering; LUV, large unilamellar vesicles; MLV,
multilamellar vesicles; MTT, 3-(4,5-dimethylthiazol-2-yl)-2,5diphenyl-tetrazolium bromide; NBD-Cl, 4-chloro-7-nitrobenz-2-oxa1,3-diazol-4-yl; PC, egg yolk phosphatidylcholine; PS, bovine brain
phosphatidylserine; SUV, small unilamellar vesicles;
TFE, 2,2,2-trifluoroethanol.
(Received 27 November 2003, revised 21 January 2004,
accepted 3 February 2004)
Keywords: penetratin; Antennapedia homeodomain; lipid
vesicles; membrane; cellular internalization.
FEBS 2004
1188 B. Christiaens et al. (Eur. J. Biochem. 271)
Table 1. Sequence, mean hydrophobicity (<H0>), hydrophobic helical moment (<lH>) and the a-helix percentage of WT penetratin and variant
peptides in buffer, in 50% TFE and in the presence of PC/PS (70 : 30, w/w) SUV at 0.02 and 0.05 peptide/lipid molar ratios (P/L). (Amino acid
substitutions are indicated in bold and underlined.)
% a-Helix
Peptide
Sequence
<H0>
<lH>
Buffer
50% TFE
P/L 0.02
P/L 0.05
WT
W48F
W56F
K46A/R53A
K46A/K57A
R53A/K57A
R52A/K55A
RQIKIWFQNRRMKWKK(43-58)
)0.61
)0.58
)0.58
)0.28
)0.34
)0.28
)0.28
0.29
0.31
0.31
0.34
0.21
0.29
0.57
8
7
8
10
10
9
10
55
59
61
57
49
60
56
46
37
45
50
54
57
59
26
13
20
39
44
54
18
RQIKIFFQNRRMKWKK(43-58)
RQIKIWFQNRRMKFKK(43-58)
RQIAIWFQNRAMKWKK(43-58)
RQIAIWFQNRRMKWAK(43-58)
RQIKIWFQNRAMKWAK(43-58)
RQIKIWFQNARMAWKK(43-58)
of the penetratin peptide, we synthesized penetratin variants
with double substitutions of Lys or Arg residues to Ala,
in order to modify clusters of positive charges along the
penetratin sequence (Table 1).
31
P-NMR data suggest that penetratin internalization
into cells involves formation of inverted micelles in the
membrane, including the insertion of the aromatic Trp
and Phe residues into the hydrophobic core of the bilayer
[7,9,30–32]. Substitution of both Trp residues in position 48
and 56 by Phe residues (W48F/W56F-penetratin) inhibits
peptide internalization [6], indicating a key role of the Trp
residues in the cellular internalization. In order to investigate
the specific contribution of Trp48 compared to Trp56, we
substituted these residues individually for Phe.
For each of these variants, we monitored several parameters determining the peptide–membrane interaction in a
model membrane system. The secondary structure of the
peptides was measured by circular dichroism. Peptide
binding to vesicles was monitored by intrinsic Trp fluorescence quenching by the phospholipid headgroups, while
quenching by acrylamide and brominated phospholipids
monitored the depth of insertion of the peptides into the
lipid bilayer. Membrane destabilization was investigated by
measuring calcein leakage and vesicle aggregation. For all
penetratin variants, cellular internalization into MDCK
cells was measured by flow cytometry and subcellular
localization by confocal microscopy. Dithionite quenching
of the fluorescently 4-chloro-7-nitrobenz-2-oxa-1,3-diazol4-yl (NBD)-labelled peptides was used to quantify the
amount of extracellularly associated and of intracellularly
accumulated penetratin peptide [22,33]. A combined analysis of the data obtained with these variants, both in the
model membrane system and with MDCK cells, provided
further insight into the membrane interaction mechanism of
penetratin.
Materials and methods
Materials
Egg yolk phosphatidylcholine (PC), 4-chloro-7-nitro-1,2,3benzoxadiazole (NBD-Cl) and trifluoroethanol (TFE) were
purchased from Sigma Chemical Co. Brain phosphatidylserine (PS), 1-palmitoyl-2-stearoyl-(6-7)dibromo-sn-glycero3-phosphocholine (Br6,7-PC) and 1-palmitoyl-2-stearoyl(11-12)dibromo-sn-glycero-3-phosphocholine (Br11,12-PC)
were from Avanti Polar Lipids (Alabaster, AL, USA).
Calcein was from Fluka. The N-alphaFMOC-amino acids
and reagents for peptide synthesis and sequencing were
from Novabiochem and Sigma Chemical Co. Sodium
dithionite was from Merck.
Peptide synthesis
The unlabelled peptides were synthesized as described
earlier using the Fmoc-tBu strategy on an AMS 422 peptide
synthesizer (ABIMED, Germany) by Synt:em (Nimes,
France) [20]. Peptides were purified by reverse-phase HPLC
using an acetonitrile gradient in an aqueous solution of
0.1% (v/v) trifluoroacetic acid. Purified peptides eluted as
a single peak and the expected molar masses were checked
by MALDI-TOF MS [34]. Peptides were lyophilized and
stored at 4 C. Concentrations of freshly prepared peptide
solutions in buffer were determined by absorbance measurements at 280 nm, using a molar absorption coefficient of
5600 M)1Æcm)1 per Trp residue.
Synthesis of N-terminal NBD-labelled penetratin peptides was carried out by Fmoc-tBu synthesis on a 431 A
peptide synthesizer (Applied Biosystems Inc., USA), as
described previously. Resin-bound peptides were treated
with piperidine [20% (v/v) in N-methyl-2-pyrrolidone] in
order to remove the N-terminal Fmoc protecting group.
NBD-Cl was added in dry dimethylformamide (sixfold
molar excess), in the presence of N,N-diisopropylethylamine, at a twofold molar excess, for 14 h under shaking in
the dark (22 C). Washing of the resin-bound peptide with
dried dimethylformamide was followed by a second reaction
with NBD-Cl (3 h at 22 C). The resin was washed with
N-methyl-2-pyrrolidone and treated with trifluoroacetic
acid/thioanisole/1,2 ethanedithiol/H2O/phenol [10 : 0.5 :
0.25 : 0.5, v/v/v/v, + 5.3% (g/v) crystalline phenol] to
cleave the peptides from the resin and deprotect the sidechains. Peptides were purified as described above. Peptide
concentrations were determined by absorbance measurements at 460 nm, using a molar absorption coefficient of
22 000 M)1Æcm)1 for the NBD label.
Vesicle preparation
Multilamellar vesicles (MLV) were prepared by vortex
mixing of lipid films in buffer. Small unilamellar vesicles
were prepared by sonication as described previously [20].
FEBS 2004
Penetratin interaction with biological membranes (Eur. J. Biochem. 271) 1189
Large unilamellar vesicles (LUV) were prepared by freezethawing MLV in liquid nitrogen (5·), and extrusion of the
lipid suspension 15· through two stacked 100 nm pore
size polycarbonate filters (Nucleopore) in a pressing
extruder (Lipex Biomembranes, Vancouver, Canada),
and stored at 4 C. Vesicle size was checked by dynamic
light scattering on a Malvern 4800 PCS equipped with
an Ar laser (488 nm). Total phospholipid and phosphatidylcholine concentration were determined as described
previously [20].
Trp fluorescence titrations
Trp fluorescence titrations were performed in a 10 mM Tris/
HCl buffer, pH 8.0, containing 0.15 M NaCl, 3 mM EDTA
and 1 mM NaN3, on an Aminco Bowman series 2 spectrofluorometer (BRS, Drogenbos, Belgium), equipped with a
thermostatically controlled cuvette holder (22 C). Emission
spectra of 2 lM peptide solutions were recorded between
310 and 450 nm, with an excitation wavelength of 280
(± 4) nm. Maximal Trp fluorescence emission wavelengths
were derived from instrument corrected spectra. As described previously, the apparent dissociation constants (Kd)
were calculated from plots of the fluorescence intensity
decrease at 350 nm, expressed as the percentage of the
fluorescence intensity of lipid-free peptide, vs. the added
lipid concentration, by curve-fitting using SIGMAPLOT (SPSS
Inc., Chicago, IL, USA) [20].
Circular dichroism measurements
CD measurements of 22 lM peptide solutions were carried
out at room temperature on a Jasco 710 spectropolarimeter
(B&L Systems, Zoetemeer, the Netherlands) between 184
and 260 nm in quartz cells with a path length of 0.1 cm, as
described previously [20]. The helicity of the peptides was
determined from the mean residue ellipticity at 222 nm [35].
Trp fluorescence quenching
Trp fluorescence quenching either by acrylamide (aqueous
phase quencher) or by dibromo-PC (lipid phase quencher)
was measured on wild-type (WT) and penetratin variants,
in the same buffer as was used for the fluorescence
titrations.
Acrylamide quenching was performed on 2 lM peptide
solutions, in the absence and presence of SUV (100 lM
lipids). Stern–Volmer quenching constants (KSV) were
calculated as described previously [20]. Only the linear
part of the curves was used to calculate the KSV constants
(0–0.1 M acrylamide, R2 > 0.98).
For dibromo-PC quenching, 2 lM peptide solutions were
incubated with a 50-fold molar excess of lipids (15 min at
22 C). Emission spectra were recorded between 310 and
450 nm with an excitation wavelength of 280 nm, at slit
widths of 4 nm. The quenching efficiency (F0/F) was
calculated by dividing the Trp fluorescence intensity of
peptide in the presence of PC/PS (70 : 30, w/w) SUV (F0),
by the fluorescence intensity of peptide in the presence of
dibromo-PC/PS (70 : 30, w/w) SUV (F). F0/F was compared for quenching by Br6,7-PC and Br11,12-PC lipid phase
quenchers.
Calcein leakage assay
Dried lipid films were hydrated in a 10 mM Tris/HCl
buffer, pH 8.0, containing 0.15 M NaCl, 3 mM EDTA,
1 mM NaN3 and 70 mM calcein. Calcein-containing LUV
were prepared as described above, and nonencapsulated
calcein was removed by gelfiltration on a Sephadex G-100
column. Calcein leakage out of LUV (50 lM lipids) was
measured after 15 min incubation at 22 C in the same
buffer as was used for the fluorescence titrations. Leakage
was monitored by measuring the increase in calcein
fluorescence intensity at 520 nm, with an excitation of
490 nm and slit widths of 4 nm, of a 50-fold diluted 20 lL
sample of the peptide-lipid incubation mixture containing
50 lM lipids. The percentage leakage was calculated as:
% leakage ¼ 100 · (F – F0)/(F – FTriton), where, F0 is
fluorescence of LUV; F, fluorescence intensity after incubation with the peptide; FTriton, fluorescence intensity after
addition of 10 lL of a 5% (v/v) Triton X-100 solution
(complete lysis of the LUV).
Vesicle aggregation assay
The ability of the peptides (10 lM) to induce vesicle
aggregation was studied by monitoring the turbidity of a
LUV suspension (50 lM lipids) at 436 nm during 60 min
(22 C) on an Uvikon 941 spectrophotometer (peptide : lipid molar ratio, 0.2). The size distribution of the
LUV alone or after 30 min incubation (22 C) with peptide
was determined by dynamic light scattering (DLS) experiments on a Malvern 4800 PCS equipped with an Ar laser
(488 nm). Hydrodynamic diameters (dH, nm) were calculated from the diffusion coefficient (D) using the Stokes–
Einstein equation: dH ¼ (kB T)/(3p · g · D), where, kB is
the Boltzmann constant; T, the absolute temperature (K)
and g the viscosity (mPaÆs)1) of the solvent. The measurements were performed in triplicate. Vesicle aggregation was
monitored in the same buffer as was used for the fluorescence titrations.
Haemolysis
Red blood cells (RBC) were isolated from human
plasma and washed three times with NaCl/Pi. RBCs at
14.4 · 106ÆmL)1 in NaCl/Pi were incubated with peptide
concentrations ranging from 2 to 100 lM for 30 min at
37 C. Haemolysis was monitored by absorbance measurements of the supernatants (5 min at 3000 r.p.m.) at 576 nm
and compared with supernatants of lysed RBCs after
addition of 0.25% (v/v) Triton X-100.
MTT reduction assay
MDCK cells were grown in DMEM supplemented with
10% foetal bovine serum, 1% glutamine and 0.5% penicillin/streptomycin (104 IUÆmL)1), further referred to as
complete medium. Cells were seeded at 4 · 105 cellsÆcm)2
in 24-well plates and grown for 24 h in complete medium.
Prior to incubation, the cells were washed and grown in
DMEM for 2 h at 37 C. Peptides were added for 30 min at
37 C, followed by addition of 3-(4,5-dimethylthiazol-2-yl)2,5-diphenyl-tetrazolium bromide (MTT) at a concentra-
FEBS 2004
1190 B. Christiaens et al. (Eur. J. Biochem. 271)
tion of 1 gÆL)1 and further incubated for 1 h at 37 C. Cells
were lysed with 50% (v/v) dimethylformamide and 20%
(w/v) SDS and absorbance was measured at 555 nm. The
percentage decrease in MTT reduction of treated cells was
compared with the MTT activity of untreated cells (100%
cell viability).
Flow cytometry
Cells were seeded at 8 · 104 cellsÆcm)2 in 12-well plates and
grown for 24 h in complete medium. Before incubation with
the NBD-labelled penetratin peptides, the cells were washed
and preincubated in DMEM for 1 h at 37 C. Cells were
then incubated with 10 lM NBD-labelled peptide, either for
1 h at 37 C, or for 4 h at 4 C, washed and placed in
400 lL ice-cold NaCl/Pi. For determination of intracellular
NBD fluorescence only, cells were placed on ice and
incubated for 5 min with 40 lL of a freshly prepared
dithionite solution (1 M sodium dithionate in 1 M Tris,
pH 10.0), washed and placed in ice-cold NaCl/Pi. Cells were
dissociated with 300 lL Cell Dissociation Buffer (Life
Technologies) and mixed with 300 lL NaCl/Pi containing
1% foetal bovine serum.
NBD-labelled peptides were excited at 488 nm and
fluorescence was measured at 525 nm using a FACScalibur
(Becton Dickinson) yielding the mean fluorescence intensity
per cell, which is a measure for the amount of cell-associated
peptide. Data are reported as mean ± SD for at least
triplicate samples.
Confocal microscopy
Cells were seeded at 16 · 104 cellsÆcm)2 in LaboratoryTek German borosilicate coverglass with eight chambers
(Nalge Nunc International) and grown for 48 h in
complete medium. Prior to incubation with the peptides,
cells were washed and preincubated in 200 lL Dulbecco’s
Modified Eagle’s Medium (DMEM) (30 min at 37 C).
Cells were subsequently incubated with the NBD-labelled
penetratin peptides and with 50 nM LysoTracker Red
DND-99 (Molecular Probes) for 30 min either at 4 C or
at 37 C, washed and placed in 200 lL ice-cold NaCl/Pi.
For determination of intracellular NBD fluorescence only,
cells were placed at 4 C and incubated for 5 min with
20 lL of a freshly prepared dithionite solution (1 M stock
solution in 1 M Tris, pH 10.0), washed and placed in
ice-cold NaCl/Pi. Photographs were taken with a Zeiss
model LSM410 invert on the basis of a Zeiss Axiovert
100 microscope (Carl Zeiss B.V., Sliedrecht, the Netherlands).
Fig. 1. 3D structure of WT penetratin, obtained from the NMR structure of the Antennapedia homeodomain complexed with DNA (PDB
code 1ahd, model 1), residues 43–58.
C-terminal of Trp56 (Table 1). New variants modifying the
three clusters of positive charges were designed, using the
3D structure of WT penetratin, derived from the NMR
structure of the entire Antennapedia homeodomain complexed with DNA (Fig. 1). In the K46A/R53A variant,
residue Lys46 close to Trp48 and Arg53 at a position
intermediate between Trp48 and Trp56, were substituted by
Ala. The K46A/K57A substitutions are in the vicinity of
residues Trp48 and Trp56, respectively, while the R52A/
K55A and the R53A/K57A substitutions affect most the
environment of Trp56. The mean hydrophobicity increased
for all variants, and the amphipathicity increased only for
the R52A/K55A variant (Table 1).
The contribution and relative importance of Trp48 and
Trp56 for membrane interactions and cellular internalization of penetratin peptides were studied by synthesis of
the W48F and W56F penetratin variants. The mean
hydrophobicity and amphipathicity of the variants were
not significantly affected by the WfiF substitutions
(Table 1).
Table 2. Maximal Trp emission wavelength (kmax) and apparent dissociation constants (Kd) for the binding of penetratin peptides with PC/PS
(70 : 30, w/w) SUV. SD for kmax value: 0.5 nm, number of experiments ¼ 3.
kmax (nm)
Results
Design of the penetratin variants
The sequences of WT penetratin and variant peptides are
summarized in Table 1. The primary sequence of WT
penetratin contains no negatively charged residue, but
includes seven positively charged residues, clustered in three
groups, separated by aromatic residues: Arg43, Lys46 are
located N-terminal of Trp48, Arg52, Arg53 and Lys55
between Trp48 and Trp56, and Lys57 and Lys58 are
Peptide
Buffer
PC/PS
(70 : 30, w/w) SUV
Kd (lM)
WT
W48F
W56F
K46A/R53A
K46A/K57A
R53A/K57A
R52A/K55A
347
347
347
347
347
346
346
337
339
334
341
342
339
336
6
18
3
222
214
231
172
FEBS 2004
Penetratin interaction with biological membranes (Eur. J. Biochem. 271) 1191
respectively. A blue-shift of around 5–7 nm was observed
for the K46A/R53A, K46A/K57A and R53A/K57A
variants, compared to 10 nm for the R52A/K55A variant.
Titration curves obtained by plotting the fluorescence
intensity at 350 nm as a function of the lipid concentration
(Fig. 2) provided apparent dissociation constants (Kd)
(Table 2). Similar affinities were found for WT penetratin
and the W48F and W56F variants. The K46A/R53A,
K46A/K57A, R53A/K57A and R52A/K55A substitutions
drastically decreased the binding affinity for negatively
charged PC/PS (70 : 30, w/w) SUV, as Kd values increased
up to 200 lM.
Fig. 2. Fluorescence titration curves. Curves of 2 lM WT (j), W48F
(n), W56F (·), K46A/R53A (–), K46A/K57A (d), R53A/K57A (e)
and R52A/K55A (m) penetratin peptides with PC/PS (70 : 30, w/w)
SUV. Curve-fitting of the experimental data are represented by solid
lines.
Interaction of the penetratin variants with model
membranes
Affinity of WT and penetratin variants for lipid
vesicles. Peptide binding to lipid vesicles was investigated
by intrinsic Trp fluorescence emission measurements. The
maximal Trp fluorescence emission wavelength of WT
penetratin (kmax) at 347 nm was shifted to 337 nm upon
incubation with negatively charged mixed PC/PS (70 : 30,
w/w) SUV (Table 2). The corresponding blue-shifts for
the W56F and W48F variants were 13 nm and 8 nm,
Secondary structure of WT and penetratin variants. The
secondary structure of WT penetratin in phosphate buffer
was mainly random, with only 8% a-helix (Fig. 3 and
Table 1). The a-helical content increased up to 55% in 50%
TFE. Incubation of WT penetratin with mixed PC/PS
(70 : 30, w/w) SUV at peptide : lipid molar ratios of 0.02
and 0.05, also increased the a-helical content of the peptides
(Fig. 3 and Table 1).
Insertion of WT and penetratin variants in the lipid
bilayer. Exposure of the penetratin Trp residues to the
aqueous phase was determined by acrylamide quenching,
while quenching by Br6,7-PC and Br11,12-PC incorporated
into mixed PC/PS SUV provided an estimate of the depth of
insertion into the lipid bilayer.
Acrylamide quenching of the lipid-free peptides was
around 70% of that of free Trp, indicating high exposure of
residues Trp48 and Trp56 to the aqueous phase (Table 3).
Incubation with anionic PC/PS (70 : 30, w/w) SUV
decreased KSV values, which were comparable for lipidbound WT penetratin and for the W48F, W56F, K46A/
R53A and K46A/K57A variants. However, the KSV values
were significantly lower (P < 0.01) for the R53A/K57A
Fig. 3. CD spectra of WT penetratin and R52A/K55A penetratin. WT and R53A/K57A penetratin at 22 lM in 10 mM phosphate buffer, pH 7.4 (·)
and in the presence of PC/PS (70 : 30, w/w) SUV at 0.02 (m) and 0.05 (s) peptide/lipid molar ratios. (A) WT penetratin; (B) R52A/K55A
penetratin.
FEBS 2004
1192 B. Christiaens et al. (Eur. J. Biochem. 271)
Table 3. Stern–Volmer constants (KSV) for acrylamide quenching of
Trp fluorescence of pure Trp and of penetratin peptides before and after
incubation with PC/PS (70 : 30, w/w) SUV. Results are represented as
mean ± standard deviation of four independent experiments.
)1
buffer (M )
Peptide
KSV,
Trp
WT
W48F
W56F
K46A/R53A
K46A/K57A
R53A/K57A
R52A/K55A
20.07
14.00
12.64
14.36
12.93
12.52
13.01
13.09
±
±
±
±
±
±
±
±
0.09
0.10
0.08
0.06
0.09
0.12
0.07
0.10
KSV,
PC/PS (M
19.80
2.81
2.71
2.81
2.78
2.69
2.40
2.07
±
±
±
±
±
±
±
±
)1
)
0.08
0.07
0.05
0.08
0.06
0.04
0.09
0.11
Fig. 4. Trp quenching efficiency (F0/F) of 2 lM penetratin peptides
bound to PC/PS (70 : 30, w/w) SUV (peptide/lipid molar ratio 0.02) by
Br6,7-PC (white bars) and Br11,12-PC (grey bars). Results are represented as mean ± standard deviation of at least three independent
experiments.
and R52A/K55A variants, up to 85 and 74%, respectively,
of that of lipid-bound WT penetratin, indicating higher
shielding from the quencher.
Trp fluorescence of all peptides was quenched more
efficiently by Br6,7-PC than by Br11,12-PC (Fig. 4), suggesting
that the peptides remain close to the lipid–water interface.
The W56F variant was quenched more by Br11,12-PC than
the W48F variant (P < 0.01), while Br6,7-PC quenching was
similar. Compared to WT, we observed higher quenching for
the R53A/K57A and R52A/K55A variants by both Br6,7PC and Br11,12-PC (P < 0.01), indicating a deeper insertion
of these variants into the lipid bilayer.
Membrane permeabilization by WT and penetratin
variants. In contrast to melittin, WT penetratin induced
only 15% calcein leakage from neutral PC and mixed PC/
PS (70 : 30, w/w) LUV at peptide : lipid ratios between 0.1
and 1 (Fig. 5). Leakage kinetics were faster for melittin, as
neutral and anionic vesicles were lysed completely within
two minutes, compared to 15 min for WT penetratin (data
not shown).
The W48F and W56F substitutions slightly decreased
maximal leakage, which was slightly increased by the K46A/
R53A and K46A/K57A substitutions. The R52A/K55A
and R53A/K57A substitutions significantly increased calcein leakage, on both neutral and anionic vesicles. Leakage at
40% was induced on pure PC vesicles, compared to 70%
by the R52A/K55A and 100% lysis by the R53A/K57A
variant on negatively charged mixed PC/PS (70 : 30, w/w)
vesicles. The peptide : lipid ratio at maximal leakage was
not affected by the composition of the lipid bilayer.
Vesicle
aggregation
by
WT
and
penetratin
variants. Incubation of anionic PC/PS (70 : 30, w/w)
LUV with WT penetratin at peptide : lipid ratios above
0.2, increased the D436 value (data not shown), indicative
of vesicle aggregation. Compared to WT penetratin, the
W48F substitution enhanced, whereas the W56F substitution slightly decreased aggregation of anionic PC/PS
(70 : 30, w/w) LUV, while no effect was observed with
neutral PC LUV. This was confirmed by DLS measurements of the LUV size distribution (Fig. 6). Incubation
with WT penetratin induced formation of large aggregates
(> 1000 nm), while some of the original-size vesicles
(100 nm) remained. The W48F variant converted all
100 nm LUV into larger aggregates, while the W56F
variant caused only partial LUV aggregation. DLS
measurements also confirmed that neither WT, W48F
nor W56F penetratin induced aggregation of neutral PC
LUV (data not shown).
Both turbidimetry and DLS measurements indicated that
neutral or anionic vesicles were not aggregated by any of the
K46A/R53A, K46A/K57A, R53A/K57A and R52A/K55A
variants. Incubation of LUV with penetratin peptides did
not induce formation of smaller particles.
Interaction of the penetratin variants with cells
Membrane permeabilization and cytotoxicity of WT and
penetratin variants. Unlabelled penetratin peptides
induced less than 15% haemolysis of human erythrocytes
at concentrations below 100 lM, whereas Melittin was
highly haemolytic at concentrations around 1 lM (data not
shown). The MTT reduction assay, performed on MDCK
cells in culture, showed no toxicity for any of the unlabelled
penetratin variants, at concentrations up to 100 lM (data
not shown).
Cellular association and internalization of WT and
penetratin variants. Endocytosis-independent cellular internalization was measured at 4 C. In order to obtain a
correct estimation of the amount of internalized peptide,
cells were incubated with dithionite to quench fluorescence
of any extracellularly associated peptide. Figure 7 shows the
amount of cell-associated peptide at 37 C (Fig. 7A) and
4 C (Fig. 7C), prior to dithionite quenching and the
corresponding amounts of intracellular peptide at 37 C
(Fig. 7B) and 4 C (Fig. 7D), after dithionite quenching.
Results for the variants are expressed relative to WT
penetratin. The W48F substitution only slightly decreased
the amount of cell-associated and internalized peptide at
FEBS 2004
Penetratin interaction with biological membranes (Eur. J. Biochem. 271) 1193
Fig. 5. Calcein leakage induced by peptides. WT (j), W48F (n), W56F (·), K46A/R53A (–), K46A/K57A (d), R53A/K57A (e) and R52A/K55A
(m) penetratin and by melittin (s) peptides from neutral PC LUV (A) and anionic PC/PS (70 : 30, w/w) LUV (B), as a function of peptide/lipid
molar ratio (50 lM lipids).
37 C (85% of WT). By contrast, at 4 C, the W48F
substitution reduced both cellular association (67% of
WT) and internalization (48% of WT), indicating that
endocytosis-independent uptake of this variant was less
efficient. Cellular internalization of the W56F variant was
70% of WT, both at 37 C and 4 C.
At both temperatures, the K46A/R53A substitutions
drastically decreased cellular association and internalization
of the penetratin peptide (<30% of WT), while the K46A/
K57A substitutions had no effect at any temperature. At
37 C, cellular internalization of the R53A/K57A and
R52A/K55A variants decreased significantly (<50% of
WT), although this effect was less pronounced at 4 C (60%
of WT).
Similar results were obtained for 1 h cellular incubation
with 2 lM NBD-penetratin variants at 37 C (data not
shown), suggesting that internalization is independent of the
peptide concentration.
Fig. 6. Size distribution of anionic PC/PS (70 : 30, w/w) LUV (50 lM
lipids) before and after 30 min incubation (22 °C) with penetratin peptides at a 0.2 peptide : lipid molar ratio. (A) LUV (s), LUV + WT
(j), LUV + W48F (n), LUV + W56F (·); (B) LUV (s), LUV +
K46A/R53A (–), LUV + K46A/K57A (d), LUV + R53A/K57A
(e), LUV + R52A/K55A (m).
Subcellular localization of WT and penetratin variants.
Confocal microscopy images of MDCK cells incubated
with NBD-labelled WT penetratin show green NBDpeptide fluorescence and red LysoTracker Red DND-99
fluorescence. This probe specifically stains acidic organelles,
late endosomes and lysosomes, and colocalization of the
signals yields yellow fluorescence (Fig. 8).
At 37 C, WT penetratin (10 lM) was found at the
plasma membrane, in the cytoplasm and to a smaller extent
in the nucleus (Fig. 8A). Dithionite quenching showed that
most peptide was internalized into the cytosol and nucleus
(Fig. 8B). A small amount of WT penetratin colocalized
with the LysoTracker Red DND-99 probe, indicative of
limited peptide accumulation in acidic organelles. Similar
results were obtained for the W48F, W56F, K46A/K57A,
R53A/K57A and R52A/K55A variants (data not shown).
At 37 C, the K46A/R53A variant was exclusively associated with the cell membrane, as there was no intracellular
signal. Similar results were obtained after cellular incubation with 50 lM NBD-labelled peptides, suggesting that
FEBS 2004
1194 B. Christiaens et al. (Eur. J. Biochem. 271)
Fig. 7. Cellular association and cellular internalization of 10 lM NBD-penetratin peptides by MDCK cells. (A) Before and (B) after dithionite
quenching of cells incubated for 1 h at 37 C, and (C) before and (D) after dithionite quenching of cells incubated for 4 h at 4 C. Results are
expressed as percentage of WT and are represented as mean ± SD of three independent experiments.
internalization is independent of the peptide concentration.
Cellular incubation with 50 lM NBD-labelled peptide and
propidium iodide (300 ngÆmL)1) showed no propidium
iodide uptake (data not shown). An MTT reduction assay
indicated that NBD-labelled penetratin peptides are not
cytotoxic (data not shown).
At 4 C, WT penetratin (50 lM) was mainly localized at
the plasma membrane (Fig. 8C), while dithionite quenching
suggested limited peptide localization in the cytoplasm
(Fig. 8D). No colocalization of WT penetratin with the
LysoTracker Red DND-99 probe was observed, confirming the endocytosis independent-uptake of penetratin peptides at 4 C. We obtained similar results for all variants,
except for the K46A/R53A peptide, whose NBD fluorescence was too weak to obtain clear resolution.
Discussion
Fig. 8. Confocal microscopy of NBD-WT penetratin internalization by
MDCK cells. (A) Before and (B) after dithionite quenching of 30 min
incubation with 10 lM NBD-WT penetratin at 37 C, and (C) before
and (D) after dithionite quenching of cells incubated for 30 min at 4 C
with 50 lM NBD-WT penetratin. The green signal corresponds to
NBD fluorescence; the red signal corresponds to LysoTracker Red
DND-99 fluorescence.
In this study, we designed and tested the properties of new
penetratin variants, as an approach to unravel the mechanism of cellular uptake of penetratin, and especially the
contribution of the Arg, Lys and Trp residues to this process.
As shown by fluorescence data, Trp residues are highly
exposed to the aqueous phase in lipid-free penetratin
peptides, suggesting a monomeric, rather than an aggregated structure. Circular dichroism measurements further
showed that penetratin peptides are randomly structured in
buffer, as previously reported [23–25,27–29].
As reported by Persson et al. [25], we observed quenching
of intrinsic Trp fluorescence intensity by PS headgroups
FEBS 2004
Penetratin interaction with biological membranes (Eur. J. Biochem. 271) 1195
upon vesicle binding, which enabled calculation of the
apparent dissociation constants for the penetratin variants
[20]. The K46A/R53A, K46A/K57A, R53A/K57A and
R52A/K55A substitutions increased peptide hydrophobicity and decreased the affinity for negatively charged
vesicles, suggesting that the initial interaction with anionic
membranes is mainly electrostatic, although hydrophobic
interactions might also be significant [16,20–29,36,37].
Binding of WT and penetratin variants to phospholipid
vesicles at a low peptide/lipid ratio (0.02) increased the
a-helical content of the penetratin peptide, in agreement
with previous reports [23–25,28,29]. At a high peptide/lipid
ratio (0.05), the a-helical percentage decreased, although
the CD spectra did not suggest b-structure formation, as
previously reported [24,27]. At peptide/lipid ratios above
0.05, the accuracy and interpretation of the CD spectra were
impaired by free peptides and below 0.02 by light scattering
caused by lipid vesicles.
Insertion of penetratin Trp residues into the lipid bilayer
was indicated by Trp fluorescence emission and shielding
from acrylamide quenching [20,26–28,30]. The Trp depth of
insertion, measured by quenching with brominated phospholipids, suggests that penetratin peptides remain close to
the water–lipid interface, in a tilted orientation, with a deeper
insertion of Trp48 compared to Trp56, in accordance with
previous reports [28,29,37,40]. Low leakage activity and
anionic vesicle aggregation by WT, W48F and W56F
penetratin, together with limited lysis of erythrocytes and
MDCK cells by all variants, indicate that these peptides do
not form pores [19,22,23,25,30,36,38]. Moreover, penetratins
do not behave either as fusogenic peptides [28,39] or as
peptides with detergent-like or a carpet-like properties [24].
The R52A/K55A and R53A/K57A variants, which insert
deeper into the lipid bilayer, inhibit vesicle aggregation and
increase leakage activity, suggesting that increased hydrophobicity due to RfiK and KfiA substitutions in the
vicinity of Trp56 (Fig. 1), rather than peptide amphipathicity, is critical for peptide insertion and membrane destabilization. Drin et al. obtained similar data for the AP-2AL
variant (N51A/R52A/K55L substitutions) [23], while
Persson et al. emphasized the importance of hydrophobic
interactions for partitioning of the penetratin peptide
between the lipid–water interface and the hydrophobic core
of the membrane [25].
Endocytosis-independent cellular internalization of penetratin is also dependent upon the hydrophobic environment
of Trp56, as demonstrated by the uptake of the K46A/
K57A, R53A/K57A and R52A/K55A variants, in which
one of the Lys residue flanking Trp56 was substituted to Ala
(Table 1 and Fig. 1). On the contrary, uptake was abolished
by the K46A/K53A substitutions. Endocytosis-independent
internalization of these penetratin variants thus shows that
increased destabilization of cellular membranes compensates for a decreased electrostatic binding. The functional
importance of Trp48 compared to Trp56 is stressed by the
W48F substitution, which affected endocytosis-independent
uptake at 4 C more than the W56F substitution. The high
degree of conservation of Trp48 (> 95%) among 346
homeodomains, compared to only 32% for Trp56 [1], and
the effect of the W48A and W48K substitutions reported by
Drin et al. and Fischer et al. [22,41], further support this
concept.
A similar subcellular localization was found for WT and
variant penetratins, at the exception of the K46A/R53A
variant, which was extracellularly associated with the
plasma membrane. At 37 C, penetratins were found both
at the membrane and inside living MDCK cells. Most of the
internalized peptides were in acidic, vesicular-like structures
in the cytosol, suggesting some penetratin uptake via
endocytosis at 37 C, in agreement with previous observations [41–43]. On the contrary, at 4 C, penetratins were
found at the cell membrane and mainly in the cytosol, but
not in acidic organelles, as at that temperature, penetratins
entered the cell through direct membrane interactions.
Results obtained on living, nonfixed cells do not suggest
specific peptide targeting to the nucleus, either at 4 C or at
37 C. This is in agreement with previous studies on living
SKMel37 cells [41,42], whereas in studies on fixed K562 [22]
and HaCaT cells, artefacts due to cell fixation might have
affected peptide localization [33,44]. Peptide labelling, either
with carboxyfluorescein or NBD, yielded comparable
results, ruling out artefacts due to peptide labelling with
fluorescent probes, in agreement with Fischer et al. [41].
However, NBD-labelled penetratins were uniformly distributed inside living rat brain primary neurones, rather than
in cytoplasmic vesicles (data not shown), suggesting that
internalization might depend upon the cell type.
Although vesicular interactions cannot be fully extrapolated to cellular interactions, the approach used in this
study provides new insights into the endocytosis-independent internalization of penetratin peptides. We propose
the following mechanism for penetratin–membrane interaction: monomeric penetratin peptides first partition
between aqueous phase and membrane, mainly due to
electrostatic interactions between the peptide basic residues and negatively charged lipids. These interactions
stabilize the a-helical conformation of lipid-bound peptides, which insert into the core of the membrane at a
tilted orientation. The two penetratin Trp residues remain
close to the lipid–water interface, and Trp48 inserts deeper
into the membrane. Peptide insertion, which is critical for
bilayer destabilization, is modulated by the hydrophobic
environment of Trp56, and especially by residues Arg52,
Arg53, Lys55 and Lys57. Besides residue Trp48, the
hydrophobic environment of Trp56 also contributes to the
endocytosis-independent cellular uptake into MDCK cells.
Other factors, such as the cellular membrane composition
and the contribution of other penetratin residues might
further regulate the endocytosis-independent uptake and
peptide trafficking inside the cell.
Acknowledgements
The authors wish to thank E. Schacht for the use of the PCS,
J. Tavernier for the use of the flow cytometer, V. Goosens for technical
assistance during the confocal microscopy experiments and B. Vanloo
for fruitful discussions. B. Christiaens was supported by a grant from
the Flemish Institute for the Promotion of Scientific-Technological
Research (IWT).
References
1. Gehring, W.J., Affolter, M. & Burglin, T. (1994) Homeodomain
proteins. Annu. Rev. Biochem. 3, 487–526.
1196 B. Christiaens et al. (Eur. J. Biochem. 271)
2. Gehring, W.J., Qian, Y.Q., Billeter, M., Furukubo-Tokunaga, K.,
Schier, A.F., Resendez-Perez, D., Affolter, M., Otting, G. &
Wuthrich, K. (1994) Homeodomain-DNA recognition. Cell 78,
211–223.
3. Joliot, A., Pernelle, C., Deagostini-Bazin, H. & Prochiantz, A.
(1991) Antennapedia homeobox peptide regulates neural morphogenesis. Proc. Natl Acad. Sci. USA 88, 1864–1868.
4. Le Roux, I., Joliot, A.H., Bloch-Gallego, E., Prochiantz, A. &
Volovitch, A. (1993) Neurotrophic activity of the Antennapedia
homeodomain depends on its specific DNA-binding properties.
Proc. Natl Acad. Sci. USA 90, 9120–9124.
5. Le Roux, I., Duharcourt, S., Volovitch, M., Prochiantz, A. &
Ronchi, E. (1995) Promoter-specific regulation of gene expression
by an exogenously added homedomain that promotes neurite
growth. FEBS Lett. 368, 311–314.
6. Derossi, D., Joliot, A.H., Chassaing, G. & Prochiantz, A. (1994)
The third helix of the Antennapedia homeodomain translocates
through biological membranes. J. Biol. Chem. 269, 10444–10450.
7. Prochiantz, A. (1996) Getting hydrophilic compounds into cells:
lessons from homeopeptides. Curr. Opin. Neurobiol. 6, 629–634.
8. Pooga, M., Soomets, U., Hallbrink, M., Valkna, A., Saar, K.,
Rezaei, K., Kahl, U., Hao, J., Wiesenfeld-Hallin, S., Hökfelt, T.,
Bartfai, T. & Langel, U. (1998) Cell penetrating PNA constructs
regulate galanin receptor levels and modify pain transmission
in vivo. Nat. Biotechnol. 16, 857–861.
9. Derossi, D., Chassaing, G. & Prochiantz, A. (1998) Trojan peptides: the penetratin system for intracellular delivery. Trends Cell
Biol. 8, 84–87.
10. Prochiantz, A. (1998) Peptide nucleic acid smugglers. Nat. Biotechnol. 16, 819–820.
11. Rousselle, C., Clair, P., Lefauconnier, J.M., Kaczorek, M.,
Scherrmann, J.M. & Temsamani, J. (2000) New advances in
the transport of doxorubicin through the blood–brain barrier
by a peptide vector-mediated strategy. Mol. Pharmacol. 57,
679–686.
12. Dunican, D.J. & Doherty, P. (2001) Designing cell-permeant
phosphopeptides to modulate intracellular signaling pathways.
Biopolymers 60, 45–60.
13. Braun, K., Peschke, P., Pipkorn, R., Lampel, S., Wachsmuth, M.,
Waldeck, W., Friedrich, E. & Debus, J. (2002) A biological
transporter for the delivery of peptide nucleic acids (PNAs) to the
nuclear compartment of living cells. J. Mol. Biol. 318, 237–243.
14. Futaki, S. (2002) Arginine-rich peptides: potential for intracellular
delivery of macromolecules and the mystery of the translocation
mechanisms. Int. J. Pharm. 245, 1–7.
15. Yakymovych, I., Engström, U., Grimsby, S., Heldin, C. &
Souchelnytskyi, S. (2002) Inhibition of transforming growth factor-beta signaling by low molecular weight compounds interfering
with ATP- or substrate-binding sites of the TGF beta type I
receptor kinase. Biochemistry 41, 11000–11007.
16. Dom, G., Shaw-Jackson, C., Matis, C., Bouffioux, O., Picard, J.,
Prochiantz, A., Mingeot-Leclercq, M.-P., Brasseur, R. &
Rezsohazy, R. (2003) Cellular uptake of Antennapedia Penetratin
peptides is a two-step process in which phase transfer precedes
a tryptophan-dependent translocation. Nucleic Acids Res. 31,
556–561.
17. Lindgren, M., Hallbrink, M., Prochiantz, A. & Langel, U.
Cell-penetrating peptides. (2000) Trends Pharmacol. Sci. 21,
99–103.
18. Stephens, D.J., & Pepperkok, R. The many ways to cross
the plasma membrane. (2001) Proc. Natl Acad. Sci. USA 98,
4295–4298.
19. Derossi, D., Calvet, S., Trembleau, A., Brunissen, A., Chassaing,
G. & Prochiantz, A. (1996) Cell internalization of the third helix of
the Antennapedia homeodomain is receptor-independent. J. Biol.
Chem. 271, 18188–18193.
FEBS 2004
20. Christiaens, B., Symoens, S., Vanderheyden, S., Engelborghs, Y.,
Joliot, A., Prochiantz, A., Vandekerckhove, J., Rosseneu, M. &
Vanloo, B. (2002) Tryptophan fluorescence study of the interaction of penetratin peptides with model membranes. Eur. J.
Biochem. 269, 2918–2926.
21. Bellet-Amalric, E., Blaudez, D., Desbat, B., Graner, F., Gauthier,
F. & Renault, A. (2000) Interaction of the third helix of Antennapedia homeodomain and a phospholipid monolayer, studied by
ellipsometry and PM-IRRAS at the air–water interface. Biochim.
Biophys. Acta 1467, 131–143.
22. Drin, G., Mazel, M., Clair, P., Mathieu, D., Kaczoreck, M. &
Temsamani, J. (2001) Physico-chemical requirements for cellular
uptake of pAntp peptide. Role of lipid-binding affinity. Eur. J.
Biochem. 268, 1304–1314.
23. Drin, G., Demene. H., Temsamani, J. & Brasseur, R. (2001)
Translocation of the pAntp peptide and its amphipathic analogue
AP-2AL. Biochemistry 40, 1824–1834.
24. Persson, D., Thorén, P.E. & Nordén, B. (2001) Penetratin-induced
aggregation and subsequent dissociation of negatively charged
phospholipid vesicles. FEBS Lett. 505, 307–312.
25. Persson, D., Thorén, P.E., Herner, M., Lincoln, P. & Nordén, B.
(2003) Application of a novel analysis to measure the binding of
the membrane-translocating peptide penetratin to negatively
charged liposomes. Biochemistry 42, 421–429.
26. Magzoub, M., Kilk, K., Eriksson, L.E., Langel, U. & Graslund,
A. (2001) Interaction and structure induction of cell-penetrating
peptides in the presence of phospholipid vesicles. Biochim. Biophys. Acta 1512, 77–89.
27. Magzoub, M., Eriksson, L.E. & Graslund, A. (2002) Conformational states of the cell-penetrating peptide penetratin when
interacting with phospholipid vesicles: effects of surface charge
and peptide concentration. Biochim. Biophys. Acta 1563, 53–63.
28. Magzoub, M., Eriksson, L.E. & Gräslund, A. (2003) Comparison
of the interaction, positioning, structure induction and membrane
perturbation of cell-penetrating peptides and non-translocating
variants with phospholipid vesicles. Biophys. Chem. 103, 271–288.
29. Lindberg, M., Biverstahl, H., Gräslund, A. & Mäler, L. (2003)
Structure and positioning comparison of two variants of penetratin in two different membrane mimicking systems by NMR.
Eur. J. Biochem. 270, 3055–3063.
30. Berlose, J.-P., Convert, O., Derossi, D., Brunissen, A. & Chassaing, G. (1996) Conformational and associative behaviours of the
third helix of antennapedia homeodomain in membrane-mimetic
environments. Eur. J. Biochem. 242, 372–386.
31. Prochiantz, A. (1999) Homeodomain-derived peptides. In and out
of the cells. Ann. NY. Acad. Sci. 886, 172–179.
32. Prochiantz, A. (2000) Messenger proteins: homeoproteins, TAT
and others. Curr. Opin. Cell Biol. 12, 400–406.
33. Richard, J.P., Melikov, K., Vives, E., Ramos, C., Verbeure, B.,
Gait, M., Chernomordik, L.M. & Lebleu, B. (2003) Cell-penetrating peptides. A reevaluation of the mechanism of cellular
uptake. J. Biol. Chem. 278, 585–590.
34. Gevaert, K., De Mol, H., Puype, M., Houthaeye, T., De Boeck, S.
& Vandekerckhove, J. (1998) Sample preparation procedures for
ultrasensitive protein identification by PSD-MALDI-TOF mass
spectrometry. J. Protein Chem. 17, 560.
35. Chen, Y.H., Yang, J.T. & Martinez, H.M. (1972) Determination
of the secondary structures of proteins by circular dichroism and
optical rotatory dispersion. Biochemistry 11, 4120–4131.
36. Thorén, P.E., Persson, D., Karlsson, M. & Nordén, B. (2000)
The antennapedia peptide penetratin translocates across lipid
bilayers – the first direct observation. FEBS Lett. 482, 265–268.
37. Salamon, Z., Lindblom, G. & Tollin, G. (2003) Plasmon-waveguide resonance and impedance spectroscopy studies of the
interaction between Penetratin and supported lipid bilayer membranes. Biophys. J. 84, 1796–1807.
FEBS 2004
Penetratin interaction with biological membranes (Eur. J. Biochem. 271) 1197
38. London, E. (1994) Analyzing the structure of polypeptides in
membranes by fluorescence quenching. Biophys. J. 67, 1368–1369.
39. Pillot, T., Goethals, M., Vanloo, B., Talussot, C., Brasseur, R.,
Vandekerckhove, J., Rosseneu, M. & Lins, L. (1996) Fusogenic
properties of the C-terminal domain of the Alzheimer beta-amyloid peptide. J. Biol. Chem. 271, 28757–28765.
40. White, S. & Wimley, W. (1999) Membrane protein folding and
stability: physical principles. Annu. Rev. Biophys. Biolmol. Struct.
28, 319–365.
41. Fischer, R., Waizenegger, T., Kohler, K. & Brock, R. (2002) A
quantitative validation of fluorophore-labelled cell-permeable
peptide conjugates: fluorophore and cargo dependence of import.
Biochim. Biophys. Acta 1564, 365–374.
42. Waizenegger, T., Fischer, R. & Brock, R. (2002) Intracellular
concentration measurements in adherent cells: a comparison of
import efficiencies of cell-permeable peptides. Biol. Chem. 383,
291–299.
43. Thorén, P.E., Persson, D., Isakson, P., Goksör, M., Önfelt, A. &
Nordén, B. (2003) Uptake of analogs of penetratin, Tat (48–60)
and oligoarginine in live cells. Bioch. Biophys. Res. Comm. 307,
100–107.
44. Fischer, P.M., Zhelev, N.Z., Wang, S., Melville, J.E., Fahraeus, R.
& Lane, D.P. (2000) Structure-activity relationship of truncated
and substituted analogues of the intracellular delivery vector
Penetratin. J. Pept. Res. 55, 163–172.
Basisprincipes van de fysicochemische studie van peptide-lipideninteracties
Bart Christiaens
Bereiden van vesikels of liposomen
Lipidenfilms worden bekomen door het drogen van
lipiden uit een organisch solvent. Door hydratatie van
lipidenfilms worden multilamellaire vesikels (MLV, Ø
200 nm - enkele µm) bekomen, die bestaan uit
verschillende concentrische dubbellagen. Door ultrasonicatie worden MLV omgezet tot kleine unilamellaire
vesikels (SUV, Eng. small unilamellar vesicles, Ø 20-40
nm). Grote unilamellaire vesikels (LUV, Eng. large
lamellar vesicles, Ø 100-500 nm) worden bereid door
extrusie van MLV. SUV hebben een grotere curvatuur
dan LUV.
Hierdoor is de energie die ze verliezen bij het
terugvallen naar de grondtoestand altijd kleiner dan de
energie die werd opgenomen bij de excitatie. Omdat de
energie omgekeerd evenredig is met de golflengte, heeft
het emissielicht bijgevolg altijd een langere golflengte
dan het excitatielicht. Dit verschil in golflengte wordt
de Stokes shift genoemd (7).
Blue shift als indicatie voor peptide-lipideninteracties
De solvent relaxatie en de Stokes shift zijn afhankelijk
van de polariteit van het milieu waarin de fluoroforen
zich bevinden. In een polair milieu zullen de
fluoroforen meer energie verliezen door
dipoolinteracties, dan in een apolair milieu. Daardoor
zijn de emissie-energie en de corresponderende emissiegolflengte, respectievelijk lager en langer in een polaire
dan in een apolaire omgeving (Fig. 2).
MLV
T↑
Vortex
SUV
+ buffer
Lipiden
opgelost in
organisch Lipidenfilm
solvent
Diameter:
20-40 nm
Gevormd door: sonicatie
Lipidendubbellaag
LUV
EXCITATIE
EMISSIE
Solventrelaxatie
S1
100-500 nm
extrusie
«French press »
Stokes shift
Figuur 1. Bereiding van vesikels (MLV, multilamellaire
vesikels; SUV, kleine unilamellaire vesikels; LUV, grote
unilamlellaire vesikels).
blue shift (Δλ)
S0
EA
λA
Tryptofaan als intrinsieke fluorescente probe
Fluorescentie is een proces dat opgedeeld wordt in twee
stappen (Fig. 2):
- excitatie, waarbij fluoroforen in een hoger
energieniveau terechtkomen door absorptie van
licht, gevolgd door
- emissie, waarbij het fluorofoor terugvalt naar de
energetische grondtoestand, door het uitstralen van
fluorescentielicht.
Tryptofaan (Trp) is een aromatisch aminozuur dat
fluoresceert en als intrinsiek fluorescente probe wordt
gebruikt bij de studie van peptide-lipide interacties.
Tryptofaan wordt geëxciteerd door absorptie van licht
met een golflengte van 280 nm en straalt fluorescent
emissielicht met een golflengte rond 340 nm. Om de
bijdrage van het excitatielicht te vermijden, wordt de
fluorescentie emissie-intensiteit onder een hoek van 90°
gemeten.
Solventrelaxatie en Stokes shift
In tegenstelling tot absorbantie, is fluorescentie sterk
afhankelijk van de polariteit van het milieu waarin het
fluorofoor zich bevindt.
Door solventrelaxatie, dit zijn dipoolinteracties met de
solventmoleculen, verliezen de geëxciteerde fluoroforen
een gedeelte van hun energie, waardoor ze terugvallen
naar het laagste geëxciteerde energienieveau (Fig. 2).
Doctoraatsthesis Bart Christiaens
Universiteit Gent 2004
Apolair
OD
>
<
&
polair milieu
EE,apol > EE,pol
λE,apol < λE,pol
Δλ
FI
golflengte
Figuur 2. Vereenvoudigd Jablonski diagram en spectra van
de excitatie en emissie van een fluorofoor in apolair en polair
milieu (OD, optische densiteit; FI, fluorescentie emissieintensiteit; S0, grondtoestand; S1, aangeslagen toestand; E,
energie; λ, golflengte).
Zo varieert de maximale tryptofaan fluorescentie
emissiegolflengte van 330 nm, voor een apolaire, tot 350
nm, voor een polaire omgeving.
Bij lipidenbinding gaan de tryptofaan residu’s van
peptiden over van de polaire, waterige buffer naar de
minder polaire lipidendubbellaag. Hierdoor treedt de
zgn. ‘blue shift’ (Δλ) op: de maximale tryptofaan
emissiegolflengte verschuift van 350 nm naar lagere
golflengten (Fig. 1 in (4)). De blue shift waarde is
indicatief voor membraaninsertie van peptiden, maar
kan mathematisch niet gecorreleerd worden met de
insertiediepte (9).
Bijlage 3, pag. 1
Tryptofaan fluorescentie leeftijdsmetingen om de
interactie van Penetratin met de fosfatidylserine
hoofdgroep aan te tonen
De blue shift die optreedt bij binding van tryptofaan
bevattende peptiden aan lipidendubbellagen, gaat
meestal gepaard met een toename in de tryptofaan
fluorescentie intensiteit.
In het geval van Penetratin binding met negatief geladen
fosfatidylcholine (PC) / fosfatidylserine (PS) SUV,
treedt daling (of quenching) van de tryptofaan
fluorescentie intensiteit op (Fig. 2 in (4)).
Het verklaren van de fluorescentie intensiteitsdaling is
niet eenvoudig doordat ze sterk afhankelijk is van
verscheidene factoren, zoals dipoolinteracties met het
solvent, interactie met andere moleculen,...
Om de oorzaak van de intensiteitsveranderingen te
onderzoeken, wordt daarom de fluorescentie leeftijd (τ)
van de fluoroforen bepaald. Dit is de tijd gedurende
dewelke het fluorofoor licht uitzendt.
Tryptofaan heeft drie leeftijden, overeenkomstig de drie
gekende rotameren van chi1 (Cα-Cβ) (12). De amplitude
van elke leeftijd en de resulterende gemiddelde leeftijd,
worden bepaald door vergelijking met de N-acetyltryptofaanamide standaard. Daardoor kan de tryptofaan
leeftijd bepaald worden in aan- en afwezigheid van al
dan niet negatief geladen vesikels en wordt informatie
over het quenchingmechanisme bekomen.
Bepaling van de schijnbare dissociatieconstante door
middel van intensiteitsveranderingen
Door de tryptofaan fluorescentie intensiteitsverandering
bij ligandbinding uit te zetten in functie van de
toegevoegde hoeveelheid ligand, worden de schijnbare
dissociatie- of associatieconstanten berekend (Fig. 2 in
(4) en Fig. 2 in (3)).
De vergelijkingen die gebruikt werden voor het
berekenen van de dissociatieconstanten bij binding van
de Penetratin peptiden aan vesikels zijn beschreven in
Experimental Procedures in (4).
Figuur 3. Fysicochemische parameters die membraaninsertie
van peptiden aanduiden.
Quenching van fluoroforen
Aangeslagen fluoroforen kunnen niet alleen door
fluorescente emissie terugvallen naar de grondtoestand,
maar ook door energieoverdracht op andere moleculen.
Deze non radiative processen resulteren in een
verlaagde fluorescentie emissie-intensiteit (7).
In het geval dat de overdracht gebeurt door dipooldipoolinteracties met andere fluoroforen, spreekt men
van resonantie energie transfer (RET). Wanneer de
Doctoraatsthesis Bart Christiaens
Universiteit Gent 2004
overdracht gebeurt door interactie met niet
fluorescerende moleculen, spreekt men van quenching.
Bij botsingsq u e n c h i n g verliest het aangeslagen
fluorofoor zijn energie door een mechanisme botsing
met de quencher. Bij statische quenching verliest het
fluorofoor zijn energie door binding met de quencher.
Waterfase quenching van tryptofaan
Omdat blue shift waarden niet gecorreleerd zijn met de
insertiediepte van tryptofaan residu’s in
lipidendubbellagen, is het noodzakelijk de insertiediepte
te bepalen via quenching van tryptofaan fluorescentie.
Acrylamide monomeren (5) en iodide ionen (8) zijn
wateroplosbaar en worden gebruikt als waterfase
botsingsquenchers. De toegankelijkheid van tryptofaan
residu’s van peptiden en proteïnen voor deze waterfase
quenchers wordt bepaald door titratie van een peptideoplossing met de quenchers en wordt kwantitiatief
uitgedrukt door de Stern-Volmer (KSV) quenching
constante:
F0 / F = 1 + KSV . [quencher]
met F0, de fluorescentie intensiteit in afwezigheid van
quencher; F, de fluorescentie intensiteit in aanwezigheid
van de quencher; en F0/F, de quenchingefficiëntie (Fig.3
in (4)).
De binding van peptiden met de lipidendubbellaag van
SUV gaat gepaard met het afschermen van de tryptofaan
residu’s van de waterfase, wat zich reflecteert in een
daling van de Stern-Volmer (KSV) quenching constante
(Fig. 3).
Lipidenfase quenching tryptofaan fluorescentie
De insertiediepte van tryptofaan residu’s in
lipidendubbellagen wordt ook bepaald via lipidenfase
quenching met di-broom gemerkte fosfolipiden (diBrPL), waarvan de acylketens op verschillende diepte
gemerkt zijn met di-broom groepen (Fig. 4).
diBr-PL gedragen zich zoals niet gemerkte fosfolipiden
en worden in de lipidenfilm gemengd. Door hydratatie
van de lipidenfilm worden ze geïncorporeerd in de
lipidendubbellaag van SUV.
Figuur 4. Structuur van di-broom gemerkte fosfolipiden, met
aanduiding van de afstand tussen het centrum van de
lipidendubbellaag en de broom groepen.
diBr-PL quenching wordt kwantitatief uitgedrukt door
de quenchingefficiëntie F0/F (10), waarbij F0 staat voor
de tryptofaan fluorescentie intensiteit van het peptide
gebonden aan niet gemerkte SUV en F voor de
fluorescentie intensiteit van peptiden gebonden aan diBr-PL bevattende SUV (Fig. 4 in (3)).
Bijlage 3, pag. 2
Peptiden die binnendringen in de lipidendubbellaag,
interageren met de lipidenfase quenchers, wat zich
reflecteert in een hoge lipidenfase quenchingefficiëntie
(Fig. 3). De insertiediepte van peptiden in de
lipidendubbellaag wordt geschat door het vergelijken
van de quenchingefficiëntie van diBr-PL waarvan de
broom groepen op verschillende diepten zitten.
Bepaling van de secundaire structuur van
peptiden door circulair dichroisme
Lineair gepolariseerd licht kan worden opgevat als de
superpositie van twee gelijkwaardige links en rechts
draaiende circulair gepolariseerde vectoren (Fig. 5) (13).
Een optisch actieve molecule die circulair dichroisme
(CD)
vertoont
heeft
een
verschillende
absorptiecoëfficiënt voor het links- en rechtsdraaiend
circulair gepolariseerd licht, waardoor de hoeksnelheid
en de lengte van de vectoren verandert. Dit resulteert in
elliptisch gepolariseerd licht.
Volgende peptide- en proteïnecomponenten zijn optisch
actief en vertonen CD:
- het chirale Cα-atoom en het amide chromofoor van
de peptidebinding (absorbeert bij 170-250 nm),
- de aromatische aminozuren tryptofaan,
phenylalanine en tyrosine (absorberen bij 250300 nm),
- disulfidebindingen (absorberen bij 250-300 nm).
- β-turn: max. 210 nm, min. bij 190 nm.
De relatieve hoeveelheid van een secundaire structuur in
een proteïne kan geschat worden door deconvolutie van
zijn CD spectrum (http://bioinformatik.biochemtech.unihalle.de/cdnn)..
Voor korte peptiden zijn echter geen referentie spectra
beschikbaar en kan men het % α-helix berekenen uit de
ellipticiteit bij 222 nm via de formule van Chen te al.
(2).
Bepaling van de permeabilisatie
lipidendubbellagen door calceïne leakage
van
Membraanpermeabilisatie wordt bestudeerd door het
lekken van calceïne doorheen de lipidendubbellaag van
LUV (11). Calceïne is een wateroplosbaar fluorofoor
(λex 496 nm, λem 517 nm) dat bij concentraties hoger
dan 50 mM zelfquenching vertoont. Calceïne wordt
geïncorporeerd in LUV door lipidenfilms te hydrateren
in een waterige oplossing van calceïne (70 mM). Het
vrije calceïne wordt verwijderd d.m.v. gelfiltratie op een
Sephadex G-100 ontzoutingskolom.
Doordat het CD van de peptidebinding afhangt van de
conformatie van het proteïne of peptide, wordt het
gebruikt om de secundaire structuur te bepalen.
Het CD van een peptide wordt bepaald door het gemeten
verschil in absorbantie voor links- en rechtsdraaiend
gepolariseerd licht om te rekenen naar de ellipticiteit.
Het CD spectrum van een peptide wordt bekomen door
de ellipticiteit uit te zetten in functie van de golflengte
waarbij het gemeten werd (Fig. 4 in (4) en Fig. 3 in (3)).
E
E
EL
ER
EL
ER
Figuur 6. Principe van een calceïne leakage experiment.
Bij verstoring van de membraanintegriteit door de
peptide-lipideninteracties, wordt calceïne vrijgesteld en
uitverdund in het medium. Bijgevolg stijgt zijn
fluorescentie emissie-intensiteit (Fig. 6).
De vrijstelling van calceïne uit het liposoom wordt
kwantitatief uitgedrukt:
Figuur 5. Projectie van de elektrische vectoren (het licht
beweegt naar de waarnemer toe) met aanduiding van de
samenstelling van lineair gepolariseerd licht (links) en
elliptisch gepolariseerd dichroisme licht (rechts).
Op basis van de CD spectra van proteïnen waarvan de
secundaire structuur gekarakteriseerd werd door X-straal
kristallografie en door NMR spectroscopie, werden voor
de secundaire structuren van peptiden kenmerkende CD
banden gekarakteriseerd:
% leakage = (F – F0) / (FTriton– F0) x 100%.
met F0, voor de initiële fluorescentie intensiteit; FTriton,
de maximale fluorescentie intensiteit (volledige lyse
door toevoegen van 0.5% Triton X-100) en F, de
fluorescentie intensiteit na toevoeging van peptide (Fig.
5 in (3)).
- α-helix: max. bij 190 nm, min. bij 210 en 220 nm,
- β-sheet: max. bij 195 nm,
- random: min. bij 190 - 200 nm,
Doctoraatsthesis Bart Christiaens
Universiteit Gent 2004
Bijlage 3, pag. 3
Bepaling van vesikelaggregatie
dynamische lichtverstrooiing
door
Bij het belichten van een deeltjessuspensie in een
vloeistof, wordt een gedeelte van het invallend licht
gereflecteerd door de gesuspendeerde deeltjes.
Door de Brownse beweging verandert de positie van de
deeltjes in de suspensie continu. De snelheid waarmee
dir gebeurt is afhankelijk van de deeltjesgrootte, de
viscositeit en de temperatuur van het solvent.
Daardoor zal de lichtintensiteit van het gefluctueerde
licht, dat gemeten wordt onder een hoek van 90°,
fluctueren in functie van de tijd, op voorwaarde dat het
detectiegebied en de concentratie van gesuspendeerde
deeltjes voldoende klein zijn. Hoe groter de deeltjes,
hoe trager de diffusie en hoe minder fluctuaties en vice
versa (Fig. 7).
I’ < I
I’
detectiegebied
I
klein
groot
I’
tijd
Figuur 7. Dynamische lichtverstrooiing voor de bepaling van
de diameter van gesuspendeerde deeltjes (I, intensiteit van
invallend licht; I’, intensiteit van verstrooide licht).
reductie met wateroplosbaar, membraanimpermeabel
natriumdithioniet (Na2S2O4).
Voor het flip-flop experiment worden fluorescerende
nitrobenzoxadiazolyl (NBD) gemerkte fosfolipiden in de
dubbellaag van LUV geïncorporeerd.
Dithioniet quencht irreversibel de NBD-gemerkte
fosfolipiden in de buitenste laag van de LUV en wordt
verwijderd door gelfiltratie op een Sephadex G-100
ontzoutingskolom. Hierdoor worden LUV bekomen
waarbij enkel de binnenste laag gemerkt is met
fluorescent NBD-PL.
Na incubatie met peptide wordt fosfolipide flip-flop van
de binnenste naar de buitenste laag van de membraan
kwantitatief bepaald:
% flip-flop = (1- (F / F0)) x 100%
met F0, de fluorescentie intensiteit na additie van peptide
en F, de fluorescentie intensiteit na additie van
dithioniet.
Om de fosfolipide flip-flop door Penetratin te
bestuderen, werd fosfatidylserine (PS) gebruikt dat op
de hoofdgroep gemerkt is met de fluorescente NBD
probe. Er werd echter meer dan 100% flip-flop
bekomen, wat kan verklaard worden door de
membraanpermeabilisatie die Penetratin induceert.
Hierdoor lekt dithioniet naar binnen en wordt een vals
positief resultaat bekomen. Er werd niet verder
ingegaan op dit resultaat, het vormt echter wel een
bevestiging van de leakageresultaten.
Uit de fluctuaties van de lichtintensiteit in functie van de
tijd, wordt door autocorrelatie de diffusiecoëfficiënt van
de deeltjes bepaald (1).
Via Stokes-Einstein vergelijking wordt hieruit de
gemiddelde hydrodynamische diameter van de deeltjes
in suspensie berekend:
dH = (kB . T) / (3π . η . D)
met dH , de hydrodynamische diameter van de deeltjes
(nm); kB , de Boltzmann constante; T, de absolute
temperatuur (K); η, de viscositeit van het solvent (mPa .
s-1) en D, de diffusiecoëfficiënt van de deeltjes.
Door het uitzetten van het aantal deeltjes in functie van
hun molaire massa, wordt de deeltjesdistributie
bekomen (Fig. 6 in (3)).
Fosfolipide
Penetratin
flip-flop
geïnduceerd
door
Flip-flop is het verschijnsel waarbij lipiden van het ene
water-lipide grensvlak van de membraan naar het andere
bewegen. In tegenstelling tot laterale diffusie in het vlak
van de membraan, ondergaan fosfolipiden spontaan
geen flip-flop tussen de water-lipiden interfasen. Door
de aanwezigheid van membraanactieve peptiden kan
echter flip-flop geïnduceerd worden. Door Kol et al. (6)
werd een methode op punt gesteld om de flip-flop van
fosfolipiden in modelmembranen (LUV) te bestuderen
(Fig. 8).
NBD (nitrobenz-2-oxa-1,3-diazol-4-yl) is een
fluorescente probe die irreversibel gequencht wordt door
Doctoraatsthesis Bart Christiaens
Universiteit Gent 2004
Figuur 8.
Studie van fosfolipide flip-flop in de
lipidendubbellaag van LUV (de NBD-gemerkte fosfolipiden
worden voorgesteld door een sterretje).
Dithioniet quenching van NBD-fluorescent
gemerkte peptiden op cellen.
Om de hoeveelheid geïnternaliseerd peptide in cellen
correct te bepalen via flow cytometry, is het
noodzakelijk om het peptide dat extracellulair
geassocieerd is met het celoppervlak te elimineren.
Bijlage 3, pag. 4
Hiervoor worden dithioniet quenching (cf. supra) en
NBD-gemerkte peptiden gebruikt.
Tijdens de peptidensynthese worden peptiden aan de Nterminus fluorescent gemerkt met NBD. NBD-chloride
wordt toegevoegd voor het ontschermen van amino
bevattende zijgroepen, zodat elk peptide slechts 1 NBDlabel heeft (3).
Na incubatie van de cellen met NBD-gemerkte peptiden,
worden ze 5 min geïncubeerd met 100 mM dithioniet bij
4 °C. Doordat dithioniet bij 4 °C niet opgenomen wordt
door cellen, wordt enkel de extracellulair geassocieerde
NBD-fluorescentie irreversibel geëlimineerd, waardoor
een onderscheid gemaakt wordt tussen extracellulair
geassocieerd en intracellulair geaccumuleerde NBDfluorescentie.
(Fig. 7&8 in (3)).
Referenties
1. Berne, B. and A. Pecora. 1976. Biology and Physics - Dynamic Light
Scattering with Applications to Chemistry. Wiley Interscience.
2. Chen, Y.H., J.T. Yang, and H.M. Martinez. 1972. Determination of
the secondary structures of proteins by circular dichroism and optical
rotatory dispersion. Biochemistry 11:4120-4131.
3. Christiaens, B., J. Grooten, M. Reusens, A. Joliot, M. Goethals, J.
Vandekerckhove, A. Prochiantz, and M. Rosseneu. 2004. Membrane
interaction and cellular internalization of penetratin peptides.
Eur.J.Biochem. 271:1187-1197.
4. Christiaens, B., S. Symoens, S. Vanderheyden, Y. Engelborghs, A.
Joliot, A. Prochiantz, J. Vandekerckhove, M. Rosseneu, and B.
Vanloo. 2002. Tryptophan fluorescence study of the interaction of
penetratin peptides with model membranes. Eur.J.Biochem.
269:2918-2926.
5. Eftink, M. R. and Ghiron, A. Exposure of Tryptophanyl Residues in
Proteins. Quantitative Determination by Fluorescence Quenching
Studies. Biochemistry 15(3), 672-680. 1976.
6. Kol, M.A., A.I. de Kroon, D.T. Rijkers, J.A. Killian, and B. de
Kruijff. 2001. Membrane-spanning peptides induce phospholipid
flop: a model for phospholipid translocation across the inner
membrane of E. coli. Biochemistry. 40:10500-10506.
7. Lackowicz, J.R. 1999. Principles of Fluorescence Spectroscopy.
Kluwer Academic/Plenum Publishers, New York, NY 10013.
8. Lehrer S.S. 1971. Solute Perturbation of Protein Fluorescence. The
Quenching of the Tryptophyl Fluorescence of Model Compounds
and of Lysozyme by Iodide Ion. Biochemistry 10:3254-3263.
9. London, E. 1994. Analyzing the structure of polypeptides in
membranes by fluorescence quenching. Biophys.J. 67:1368-1369.
10. Mangavel, C., R. Maget-Dana, P. Tauc, J.C. Brochon, D. Sy, and
J.A. Reynaud. 1998. Structural investigations of basic amphipathic
model peptides in the presence of lipid vesicles studied by circular
dichroism, fluorescence, monolayer and modeling.
Biochim.Biophys.Acta 1371:265-283.
11. Pillot, T., M. Goethals, B. Vanloo, C. Talussot, R. Brasseur, J.
Vandekerckhove, M. Rosseneu, and L. Lins. 1996. Fusogenic
properties of the C-terminal domain of the Alzheimer beta-amyloid
peptide. J.Biol.Chem. 271:28757-28765.
12. Vos, R., Y. Engelborghs, J. Izard, and D. Baty. 1995. Fluorescence
study of the three tryptophan residues of the pore-forming domain of
colicin A using multifrequency phase fluorometry. Biochemistry
34:1734-1743.
13. Wollmer, A. 1983. ORD and CD Spectroscopy. In Biophysics. W.
Hoppe, W. Lohmann, H. Markl, and H. Ziegler, editors. SpringerVerlag, Berlin Heidelberg NewYork Tokyo.
Doctoraatsthesis Bart Christiaens
Universiteit Gent 2004
Bijlage 3, pag. 5
4
Toepassing van Penetratin
voor DNA-transfecties
4.1. Penetratin-DNA complexen transfecteren niet
In dit werk toonden we aan dat het positief geladen Penetratin peptide (pI = 12.3) een
beperkte DNA condensatie induceert door de neutralisatie van de negatieve ladingen
van DNA. Penetratin-DNA complexen zijn echter niet in staat om Cos-1 cellen te
transfecteren, waardoor Penetratin niet kan gebruikt worden als transfectievector. Dit
is in tegenspraak met Dom et al., die de internalisering van oligonucleotiden door
Penetratin in Cos-7 cellen observeerden (Dom et al., 2003). De discrepantie kan
verklaard worden door de verschillende grootte van het geïnternaliseerde DNA (wij
gebruikten een 7.2kb pCMVβ rapporteerplasmide).
4.2.
De
endolysosomale
lokalisatie
van
polymethacrylaat-DNA complexen verklaart hun
lage transfectie-efficiëntie
Zoals vermeld in de inleiding, ontwikkelt de Onderzoeksgroep Polymeermaterialen
polymethacrylaten voor DNA-transfectie. Een gedeelte van dit doctoraatswerk
bestond uit het onderzoek naar de oorzaak van de lage transfectie-efficiëntie van de
polymethacrylaat-DNA complexen. Hiertoe werden polymethacrylaten met een
verschillende chemische samenstelling gesynthetiseerd (Tabel 4).
75
De volledig geprotoneerde polymethacrylaten bevatten enkel primaire (AEMA) en
tertiaire (DMAEMA) aminogroepen. De partieel geprotoneerde polymethacrylaten
bevatten naast aminogroepen, ook imidazol (HYMIMMA) of carboxyl (MA) groepen.
De ladingsdichtheid van polymethacrylaten wordt gedefinieerd als de massa polymeer
per positieve lading, ervan uitgaande dat enkel de tertiaire aminogroepen (DMAEMA)
geprotoneerd zijn bij fysiologische pH. De ladingsdichtheid van de polymeren neemt
af met het aantal positief geladen functionele zijgroepen van het polymeer. De
polymethacrylaten werden fluorescent gemerkt met een OregonGreen® 488 of een
fluoresceïne merker.
De sub-cellulaire lokalisatie van de fluorescente
polymethacrylaat-DNA complexen werd door confocale microscopie bestudeerd in
Cos-1 cellen, en vergeleken met die van PEI-DNA complexen.
Tabel 4. Chemische samenstelling, molaire massa (MM) en ladingsdichtheid (LD) van de polymeren.
Polymeer
MM (kg/mol)
LD (g/mol)
PDMAEMA
201
194
PDMAEMA0.96-co-AEMA0.04
PDMAEMA0.87-co-AEMA0.13
273
630
193
190
PDMAEMA0.48-co-AEMA0.42-co-HYMIMMA0.10
47
201
PDMAEMA0.65-co-MA0.35
316
520
Polyethyleenimine (PEI)
25
208
Doordat polymethacrylaten aminogroepen bevatten, zijn ze bij fysiologische pH
positief geladen en interageren ze met DNA. Hierdoor worden de negatieve ladingen
van het DNA geneutraliseerd en wordt het DNA gecondenseerd en beschermd tegen de
afbraak door nucleasen (Dubruel et al., 2000 en 2002; Dubruel, 2003).
De transfectie-efficiëntie van de volledig geprotoneerde polymethacrylaten is bij een
4/1 polymethacrylaat/DNA ladingsverhouding vergelijkbaar met die van PEI-DNA
complexen en ongeveer driemaal lager dan die van Lipofectamine™-DNA lipoplexen.
De polyplexen op basis van de volledig geprotoneerde polymethacrylaten worden in
Cos-1 cellen opgenomen door endocytose. In vergelijking met PEI verloopt deze
76
internalisering echter traag. Bovendien ontsnappen de PDMAEMA0.96-co-AEMA0.04
en PDMAEMA0.87-co-AEMA0.13 polymethacrylaten minder efficiënt uit de
endosomen, waardoor ze trager in het cytosol worden vrijgesteld.
Ondanks hun goede bufferende eigenschappen, zijn de partieel geprotoneerde
polymethacrylaten niet in staat om Cos-1 cellen te transfecteren.
Confocale
microscopie toonde aan dat polyplexen op basis van deze methacrylaten voornamelijk
ter hoogte van plasmamembraan gelokaliseerd zijn. Pas na lange incubatietijden (14h) worden de PDMAEMA0.48-co-AEMA0.42-co-HYMIMMA0.10 en PDMAEMA0.65co-MA0.35 polymethacrylaten in beperkte mate geïnternaliseerd door endocytose. Ze
worden echter niet vrijgesteld in het cytosol.
Deze data tonen aan dat de transfectie-efficiëntie van polymethacrylaten in Cos-1
cellen beïnvloed wordt door de ladingsverhouding van de polyplexen en de chemische
samenstelling van de polymeren, wat overeenkomt met andere publicaties (De Smedt
et al., 2000; Dubruel et al., 2003a). Er kan ook besloten worden dat de bufferende
eigenschappen van polymethacrylaten niet voldoende zijn om een efficiënte transfectie
te bekomen. In tegenstelling tot PEI en Lipofectamine™, zijn polymethacrylaten niet
hemolytisch of cytotoxisch. Dit wijst erop dat ze de cellulaire membranen niet
destabiliseren (Dubruel et al., 2003a). Naast de endosomale buffering, zouden
membraaninteracties ook een rol kunnen spelen bij de internalisering en het
endolysosomale ontsnappingsproces van polymethacrylaat-DNA complexen.
Wij observeerden geen nucleaire targetting van PEI- of polymethacrylaat-DNA
complexen in Cos-1 cellen, in overeenkomst met andere groepen (Remy-Kristensen et
al., 2001; Bieber et al., 2002).
77
4.3. Penetratin verhoogt de transfectie-efficiëntie van
polymethacrylaat-DNA complexen
Recent werd aangetoond dat de additie van membraanpermeabiliserende, lytische
peptiden de transfectie-efficiëntie van poly-L-Lysine (PLL) en PEI kan verhogen
(Sparrow et al., 1998; Wagner, 1999). Deze transfectiesystemen zijn echter toxisch.
Om een niet toxisch transfectiesysteem te bekomen, werden in dit werk de
membraaninteracties en de transfectie-efficiëntie van polymethacrylaten verhoogd
door
de
polymethacrylaat-DNA
complexen
te
mengen
met
het
membraantranslocerende Penetratin peptide.
De polymethacrylaat-DNA inter-polyelektroliet complexen dissociëren niet door de
additie van Penetratin. De DNA-condensatie neemt zelfs licht toe. De transfectieefficiëntie van PDMAEMA0.87-co-AEMA0.13- en PDMAEMA0.48-co-AEMA0.42-coHYMIMMA0.10-DNA complexen in Cos-1 cellen wordt bovendien minstens
verdubbeld door het toevoegen van Penetratin. Door de additie van Penetratin
bereiken de PDMAEMA0.87-co-AEMA0.13-DNA complexen met een 4/1
polymethacrylaat/DNA ladingsverhouding, zelfs een transfectie-efficiëntie die
vergelijkbaar is met die van PEI en Lipofectamine™. In tegenstelling tot PEI en
Lipofectamine™, zijn polymethacrylaat-DNA-Penetratin complexen echter niet
cytotoxisch.
De hoeveelheid geïnternaliseerde polymeer-DNA complexen neemt toe voor het
partieel geprotoneerde PDMAEMA0.48-co-AEMA0.42-co-HYMIMMA0.10, maar niet
voor het volledig geprotoneerde PDMAEMA0.87-co-AEMA0.13-DNA polymeer, zoals
bepaald door flow cytometry. Beide polymethacrylaat-DNA-Penetratin complexen
worden via endocytose opgenomen door Cos-1 cellen, zoals aangetoond door
confocale microscopie.
Penetratin vermindert bovendien de endolysosomale
accumulatie van beide polymethacrylaten. Er werd geen nucleaire lokalisatie van de
polymethacrylaat-DNA-Penetratin complexen waargenomen.
78
De toename van de transfectie-efficiëntie wordt dus vooral veroorzaakt door een
versnelde endosomolyse en in mindere mate door een verhoogde cellulaire
internalisering bij de additie van Penetratin aan polymethacrylaat-DNA complexen.
Door hun lage toxiciteit voor Cos-1 cellen, vormen polymethacrylaat-DNA-Penetratin
complexen een groot potentieel voor gentherapie.
Gratton et al. toonden recent aan dat Penetratin additie ook de virale transfectieefficiëntie verhoogt (Gratton et al., 2003), terwijl andere groepen de transfectieefficiëntie van liposomen, polymeren en fagen verhoogden door additie of covalente
koppeling van het Tat CPP (Nakanishi et al., 2003; Rudolph et al., 2003; Torchilin et
al., 2003). De membraaninteragerende, niet toxische, celpenetrerende peptiden kunnen
dus gebruikt worden om de transfectie-efficiëntie van zowel virale als synthetische
transfectievectoren te verhogen.
79
4.4. Bijlagen
De resultaten van de samenwerking met de Onderzoeksgroep Polymeermaterialen
werden gepubliceerd of zijn ingediend voor publicatie in gespecialiseerde,
internationale tijdschriften.
Physicochemical and biological evaluation of cationic polymethacrylates as
vectors for gene delivery
Peter Dubruel, Bart Christiaens, Berlinda Vanloo, Ken Bracke, Maryvonne Rosseneu,
Joël Vandekerckhove and Etienne Schacht
Eur. J. Pharm. Sc. 18, 211-220 (2003)
Buffering properties of cationic polymethacrylates are not the only key to
successful gene delivery
Peter Dubruel, Bart Christiaens, Maryvonne Rosseneu, Joël Vandekerckhove, Johan
Grooten, Vera Goossens and Etienne Schacht
Biomacromolecules 5, 379-388 (2004)
Enhancement of polymethacrylate-mediated gene delivery by Penetratin
Bart Christiaens, Peter Dubruel, Johan Grooten, Marc Goethals, Joël Vandekerckhove,
Etienne Schacht and Maryvonne Rosseneu
Accepted for publication in Eur. J. Pharm. Sc.
80
European Journal of Pharmaceutical Sciences 18 (2003) 211–220
www.elsevier.com / locate / ejps
Physicochemical and biological evaluation of cationic polymethacrylates as
vectors for gene delivery
Peter Dubruel a , Bart Christiaens b , Berlinda Vanloo b,c , Ken Bracke a , Maryvonne Rosseneu b ,
¨ Vandekerckhove b,c , Etienne Schacht a,d , *
Joel
a
Polymer Materials Research Group, Department of Organic Chemistry, Ghent University, Ghent, Belgium
b
Laboratory for Lipoprotein Chemistry, Department of Biochemistry, Ghent University, Ghent, Belgium
c
Flanders Interuniversity Institute for Biotechnology ( VIB), Department of Medical Protein Research, Ghent University, Ghent, Belgium
d
Institute Biomedical Technology ( IBITECH), Ghent University, Ghent, Belgium
Received 13 May 2002; received in revised form 11 September 2002; accepted 28 November 2002
Abstract
We report here the physicochemical and biological evaluation of a series of polymethacrylates with side groups of different pKa values,
such as tertiary amines, pyridine groups, acid functions and imidazole groups as synthetic vectors for gene delivery. The ability of the
different polymers to condense DNA was studied by ethidium bromide exclusion tests and agarose gel electrophoresis. The results show
that all polymers are able to condense DNA. Both the molecular weight and the chemical composition of the polymers have an influence
on the DNA condensation process. Furthermore, the biological properties of the polymer–DNA complexes were investigated, including
their haemolytic activity, cytotoxicity and in vitro transfection efficiency. Complexes based on polymers containing only tertiary amines,
have a transfection efficiency similar to that of poly(ethyleneimine) (PEI). Polymers containing pyridine groups have a reduced
transfection efficiency compared to polymers containing tertiary amines. Introduction of imidazole groups or acid functions results in a
loss of the transfection efficiency of the corresponding complexes with DNA. In general, the viability of cells incubated with complexes
based on the polymethacrylates is higher than with PEI. Polymers with high transfection efficiency induce erythrocyte lysis.
 2002 Elsevier Science B.V. All rights reserved.
Keywords: Gene therapy; Polymethacrylates; DNA condensation; Transfection efficiency; Haemolytic activity; Polymer–DNA complexes
1. Introduction
Gene therapy is a technique in which nucleic acids are
introduced into cells with the purpose of altering the
course of a medical condition or disease. The final
objective of gene therapy is to deliver the right gene to the
right type of cell. However, DNA as such is negatively
charged and has a large hydrodynamic volume. Consequently, it has no desirable physicochemical properties for
Abbreviations: PEI: poly(ethyleneimine); Mn : numerical average molecular weight; Mw : weight average molecular weight; MTT: 3-(4,5dimethylthiazol-2-yl)-2,5-diphenyl-tetrazolium bromide; EtBr: ethidium
bromide; DMEM: Dulbecco’s modified Eagle medium; HEPES: N-(2
-hydroxyethyl)piperazine-N9-2-ethane-sulfonic acid; EDTA: ethylenediamine tetraacetic acid; FBS: fetal bovine serum; GPC: gel-permeation
chromatography, HBS: HEPES buffered saline, PLL: poly-L-lysine, SDS:
sodium dodecylsulphate
*Corresponding author. Krijgslaan 281 (S4 BIS), B-9000 Ghent,
Belgium. Tel.: 132-92-644-499; fax: 132-92-644-972.
E-mail address: [email protected] (E. Schacht).
spontaneous uptake into cells (Brock et al., 1994). To
overcome this problem, in most cases DNA is combined
with a vector. The different types of vectors studied so far
include viruses (Fasbender et al., 1997; Zabner et al.,
1993; Hay et al., 1995; Jolly, 1994; Zhou et al., 1991),
liposomes (Felgner et al., 1987; Felgner, 1990; Szoka and
Papahadjopoulos, 1978; Straubinger and Paphadjopoulos,
1983) and synthetic or natural polymers (Cherng et al.,
1997; Abdallah et al., 1996; Godbey et al., 1998; Wu and
Wu, 1987; Wagner et al., 1991). The latter type has
attracted considerable attention in recent years. The polymers studied include poly-a-L-amino acids (Erbacher et al.,
1995; Hashida et al., 1998; Kim et al., 1998; Mullen et al.,
2000; Dekie et al., 2000), vinyl polymers (Dubruel and
Schacht, 2000; Arigita et al., 1999; Dubruel et al., 2000;
Howard et al., 2000; Hinrichs et al., 1999) and polysaccharides (Richardson et al., 1999; Janes et al., 2001). One
of the synthetic polymeric vectors possessing a high
transfection activity is poly(ethyleneimine) (PEI) (Godbey
et al., 2001). According to the ‘proton sponge’ theory
0928-0987 / 02 / $ – see front matter  2002 Elsevier Science B.V. All rights reserved.
doi:10.1016 / S0928-0987(02)00280-4
212
P. Dubruel et al. / European Journal of Pharmaceutical Sciences 18 (2003) 211–220
proposed by Behr, PEI is only partially protonated at
physiological pH (Behr, 1997). In the more acidic compartment of the endosomes, additional protonation of the
amine functions occurs what results in an influx of chloride
counterions. This osmotic effect is thought to be one of the
key steps in the transfection process (Pouton and Seymour,
2001).
Starting from this theory, we were interested to evaluate
the physicochemical and biological properties of a number
of cationic polymethacrylates with functional side groups
of different pKa values, as vectors for gene delivery. The
polymers contain tertiary amines, pyridine groups, imidazole groups or acid functions. The rationale behind this
approach is to obtain polymers that are partially protonated
under physiological conditions (pH 7.4) and that have a
higher degree of protonation under the endosomal conditions (pH 5.5). We have demonstrated before that
copolymers containing tertiary amines and imidazole
groups or acid functions possess, in analogy with PEI,
buffering properties in a pH range between the physiological and the endosomal pH (Dubruel et al., 2000). The
introduction of pyridine groups had no effect on the
buffering properties. In the present study, we have investigated a possible correlation between the buffering and the
DNA condensation properties of these polymers and their
transfection efficiency.
The ability of the different polymethacrylates to condense DNA was studied by ethidium bromide exclusion
tests and agarose gel electrophoresis. These methods
provide information about the effect of both the molecular
weight and the chemical composition of the polymers on
the DNA condensation process. The biological properties
of the different polymer–DNA complexes was assessed in
terms of their transfection potential and cell viability
towards Cos-1 cells as well as their haemolytic activity.
2.2. Polymer synthesis and characterisation
The synthesis of the different polymers having different
side group functionalities, were obtained by radical polymerisation of the appropriate comonomers, as we described earlier (Dubruel et al., 2000). As a reminder, the
structures of the different types of polymers are summarised in Fig. 1. The molecular weight of the polymers was
determined by GPC. Due to adsorption phenomena on the
GPC column, the molecular weight of P(DMAEMA 0.65 –
co-MA 0.35 ) could not be determined. Therefore, the molecular weight of this polymer was determined by static light
scattering. The measurement was carried out with a
Malvern 4800, equipped with an air-cooled Ar laser
operating at 488 nm. The detector used was an Avalanche
photodiode detector.
The chemical composition, the molecular weight and the
corresponding polydispersities of the polymers are given in
Table 1.
2.3. DNA condensation studies
2.3.1. Complex formation at different charge ratios
For the calculation of the charge ratio, a mass per charge
of 325 Da was used for DNA. The mass per charge of all
cationic polymers was calculated assuming that, under the
experimental conditions, only the amine functions of the
2. Materials and methods
2.1. Materials
Penicillin, streptomycin and DMEM were obtained from
Gibco BRL姠 (Life Technologies姠). Branched PEI (Mw 5
25 kDa) and MTT were obtained from Aldrich. EtBr,
linear calf thymus DNA (15–23 kb), boric acid, agarose
(electrophoresis grade), HEPES and bromophenol blue
were obtained from Sigma. EDTA was purchased from
Fluka. Glycerol was from Vel. pCMVb plasmid (7.2 kb)
was obtained from Clontech. FBS was obtained from
Perbio. The b-gal ELISA kit was obtained from Roche.
The BCA Protein Assay kit was obtained from Pierce. The
endotoxin-free plasmid Maxiprep kit was obtained from
Qiagen. Lipofectamine姠 was from Gibco-Brl. All products
were used as received following the instructions from the
suppliers. The water used throughout this study was double
distilled.
Fig. 1. Chemical structure of P(DMAEMA), P(DMAEMA x –coHENIMA y ), P(DMAEMA x –co-MA y ) and P(DMAEMA x –co-HYMIMMA y ).
P. Dubruel et al. / European Journal of Pharmaceutical Sciences 18 (2003) 211–220
213
Table 1
Chemical composition, molecular weight, polydispersity (d 5 Mw /Mn ) and mass / charge of the different polymers
Code
Polymer
Mw
(kDa)
d
Mass / charge
(Da)
P1
P2
P3
P4
P5
P6
P7
P8
P9
P10
P11
PDMAEMA
PDMAEMA
PDMAEMA
PDMAEMA
P(DMAEMA 0.82 –co-MA 0.18 )
P(DMAEMA 0.65 –co-MA 0.35 )
P(DMAEMA 0.9 –co-HENIMA 0.1 )
P(DMAEMA 0.89 –co-HENIMA 0.11 )
P(DMAEMA 0.94 –co-HYMIMMA 0.06 )
P(DMAEMA 0.88 –co-HYMIMMA 0.12 )
P(DMAEMA 0.81 –co-HYMIMMA 0.19 )
93
110
166
201
108
316
140
164
99.5
72
54
1.6
1.3
1.3
1.4
1.3
–
1.3
1.4
1.4
1.5
1.3
194
194
194
194
272
520
221
223
205
218
237
PEI
Poly(ethyleneimine)
–
208
side groups with the highest pKa (DMAEMA) are protonated. The acid groups (MA) are deprotonated and thus
negatively charged while the pyridine groups and the
imidazole groups are supposed to be nonprotonated (neutral). The values of the mass per charge for the different
polymers are shown in Table 1. For PEI, a mass per charge
of 208 Da was used. All polymer–DNA complexes were
formed in water by adding the appropriate amount of
polymer to a solution containing DNA (20 mg / ml). After
the mixing of both compounds, the solution was vortexed.
Unless otherwise stated, the DNA used in the condensation
studies, is linear calf thymus DNA. The charge ratio is
defined as the number of cationic charges of the polymer
to the number of anionic charges from DNA.
2.3.2. Agarose gel electrophoresis
Polymer–DNA complexes were prepared in water at
different charge ratios, ranging from 0.2 / 1 to 3 / 1 (1 / 2).
After an incubation of 30 min, 20 ml of the complexes
were added to 2 ml loading buffer [50% glycerol (v / v),
100 mM Na 2 EDTA and 0.1% bromophenol blue (w / v)]
and applied on an agarose gel [1% w / v, Tris(hydroxymethyl)aminomethane–borate–EDTA, pH 8.3]. The gel
was run at 90 V for 60 min (Horizon  11–14, Life
Technologies). After electrophoresis, the gel was stained
with EtBr (0.5 mg / ml), allowing us to determine the
lowest charge ratio at which DNA condensation occurs.
The gel was imaged with a digital camera (DC 120,
Kodak).
2.3.3. Ethidium bromide exclusion tests
A sample containing DNA (20 mg / ml) and EtBr (400
ng / ml) was used to calibrate the spectrofluorometer (SFM
25, Kontron Instruments) to 100% fluorescence. The
different polymers were added stepwise to an aqueous
solution of EtBr (400 ng / ml) and DNA (20 mg / ml),
measuring the decrease of fluorescence ( lex 5510 nm,
lem 5590 nm). After each addition, the samples were left
25
to stabilise for 3 min. The results are expressed as
mean6standard deviation for triplicate samples.
2.4. Biological evaluation of polymer–DNA complexes
2.4.1. Plasmid
The plasmid used to study the transfection efficiency of
the polymers, is the pCMVb plasmid, encoding for bgalactosidase under control of the CMV promotor. The
plasmid was expanded in DH10B E. coli and was isolated
using the Qiagen endotoxin-free plasmid Maxiprep kit,
according to the supplier’s protocol. The quality and the
quantity of the purified plasmid DNA was assessed by
spectrophotometric analysis at 260 and 280 nm, as well as
by electrophoresis on a 1% agarose gel. Purified DNA was
resuspended in water and frozen (220 8C) in aliquots at a
concentration of 0.1 mg / ml.
2.4.2. Haemolysis studies
Red blood cells were isolated from bovine plasma and
buffy coat and washed three times with HBS. The different
polymer–DNA complexes were added at two different
charge ratios (2 / 1 and 4 / 1) to a 2% red blood cell solution
and incubated for 24 h at 37 8C. The supernatants were
spun off at 4000 rpm (5 min). The degree of haemolysis
for the different complexes was investigated by measuring
the released haemoglobin (absorbance measurement at 545
nm). The haemolytic activity was quantified by comparing
the values obtained for the different complexes, with those
for HBS (0% haemolysis) and a 10% Triton X-100
solution (100% haemolysis).
2.4.3. Transfection study and cytotoxicity determination
The monkey kidney fibroblast Cos-1 cell line was grown
in DMEM supplemented with 10% FBS and 1% penicillin /
streptomycin (10 4 I.U. / ml), further referred to as complete
medium. The transfection protocol used for PEI and the
polymethacrylates is based on an available protocol for
Lipofectamine姠. The day before transfection, Cos-1 cells
214
P. Dubruel et al. / European Journal of Pharmaceutical Sciences 18 (2003) 211–220
were seeded at a density of 2?10 4 cells / cm 2 in 12-well
plates, and were grown for 24 h in complete medium. Two
hours before transfection, the cells were washed twice with
DMEM and incubated for 2 h in DMEM (400 ml / well,
37 8C, 5% CO 2 ).
The transfection mixtures, containing the polymer–DNA
complexes, were prepared as follows. Three compounds
were added and mixed in a precise order: DNA, water and
polymer. The final volume of the mixtures was 80 ml,
containing 0.06 mg / ml plasmid DNA and the appropriate
amount of polymer to obtain the desired charge ratio.
Immediately after addition of the polymer, the mixtures
were vortexed for 30 s and further incubated for 2 h at
room temperature. PEI and Lipofectamine were used as
reference materials. The amount of Lipofectamine used
was 37 mg, according to the protocol of the supplier.
Then, 13 ml transfection mixture was added to each well
(780 ng DNA / well). The cells were incubated for 4 h with
the transfection mixtures (37 8C, 5% CO 2 ). After this
incubation, the cells were washed twice with DMEM and
incubated for 48 h in 1 ml complete medium (37 8C, 5%
CO 2 ). Finally, the cells were washed three times with
cooled PBS (4 8C), lysed with 1 ml lysis buffer and
harvested. The quantification of the b-gal mass was
performed using the b-gal ELISA kit, according to the
supplier’s protocol. Cellular protein determinations were
performed with the BCA protein assay kit.
The cytotoxicity of all polymer–DNA complexes was
determined by means of the MTT assay. These experiments were carried out in 24-well plates, using the same
conditions as for the transfections. After 3 h incubation of
the cells with the complexes, MTT was added (final
concentration on the cells was 1 mg / ml) and further
incubated for 1 h. Cells were lysed with 50% dimethylformamide and 20% SDS. The absorbance values were
determined using a Jasco V-550 spectrophotometer at 555
nm (reference wavelength: 700 nm), the results were
expressed as the percentage decrease in MTT reduction of
treated cells compared to the MTT activity of untreated
cells (100% cell viability).
All data are reported as mean6standard deviation for
triplicate samples.
3. Results
3.1. DNA condensation studies
The ability of the different polymers to condense DNA
was studied both by agarose gel electrophoresis and EtBr
exclusion tests.
3.1.1. Agarose gel electrophoresis
As an example, the DNA condensation pattern of the
PDMAEMA homopolymers, containing only tertiary
amines (P1–P4), is given in Fig. 2, showing that the
Fig. 2. DNA condensation patterns of PDMAEMA (P1–P4) as studied
by agarose gel electrophoresis: Mw (P1)593 kDa, Mw (P2)5110 kDa,
Mw (P3)5166 kDa, Mw (P4)5201 kDa.
amount of free DNA is gradually decreasing as a function
of the charge ratio (1 / 2). At a critical amount of
polymer, the DNA is retained in the well, indicating
complete DNA condensation. The charge ratios at which
complete DNA condensation occurs for the different
polymers, are summarised in Table 2.
It can be seen that for the PDMAEMA homopolymers,
the amount of polymer needed to get DNA in its condensed state is decreasing in the molecular weight range
93–165 kDa (P1–P3, Fig. 2 and Table 2). At a higher
molecular weight (P4, Mw 5201 kDa), the amount of
polymer needed to get complete DNA condensation increases again. We also observed an effect of the molecular
weight of the pyridine containing P(DMAEMA x –coHENIMA y ) copolymers (P7–P8), on the charge ratio
needed for DNA condensation.
For the P(DMAEMA x –co-MA y ) copolymers containing
acid functions (P5–P6), the charge ratio at which DNA
condensation occurs, increases with increasing mole% of
the acid groups (Table 2).
A similar effect was observed for the P(DMAEMA x –coHYMIMMA y ) copolymers (P9–P11) containing imidazole
groups.
3.1.2. Ethidium bromide exclusion
The results obtained by the EtBr exclusion tests are
shown in Fig. 3. It can be seen that the EtBr fluorescence
intensity decreases upon addition of the cationic polymers,
until a plateau is reached (FI min ). This decrease is caused
by the exclusion of EtBr from the DNA minor groove,
which is an indication for the DNA condensation (Gershon
P. Dubruel et al. / European Journal of Pharmaceutical Sciences 18 (2003) 211–220
215
Table 2
DNA condensation studies
Code
Polymer
Mw
(kDa)
Charge ratio
(1 / 2)a
Charge ratio to
reach FI 50 b
FI min
P1
P2
P3
P4
P5
P6
P7
P8
P9
P10
P11
PDMAEMA
PDMAEMA
PDMAEMA
PDMAEMA
P(DMAEMA 0.82 –co-MA 0.18 )
P(DMAEMA 0.65 –co-MA 0.35 )
P(DMAEMA 0.9 –co-HENIMA 0.1 )
P(DMAEMA 0.89 –co-HENIMA 0.11 )
P(DMAEMA 0.94 –co-HYMIMMA 0.06 )
P(DMAEMA 0.88 –co-HYMIMMA 0.12 )
P(DMAEMA 0.81 –co-HYMIMMA 0.19 )
93
110
166
201
108
316
140
164
99.5
72
54
1.8 / 1
1.6 / 1
1.4 / 1
1.6 / 1
1.2 / 1
1.6 / 1
1.6 / 1
1.4 / 1
1.0 / 1
1.6 / 1
3.0 / 1
0.8 / 1–0.9 / 1
0.7 / 1–0.8 / 1
0.5 / 1–0.6 / 1
0.7 / 1–0.8 / 1
0.7 / 1–0.8 / 1
1 / 1–1.1 / 1
0.9 / 1–1.0 / 1
0.7 / 1–0.8 / 1
0.7 / 1–0.8 / 1
1.3 / 1–1.4 / 1
2.7 / 1–2.8 / 1
11.4
18.2
21.5
16.1
25.2
33.6
24.0
24.6
27.4
30.8
11.0
PEI
Poly(ethyleneimine)
25
0.6 / 1
0.3 / 1–0.4 / 1
17.4
a
Charge ratio of complete DNA condensation as studied by agarose gel electrophoresis.
b
DNA condensation as studied by EtBr exclusion tests. These values represent the charge ratio at which the fluorescence signal reaches 50% of the
original value.
Fig. 3. Decrease of the percentage EtBr fluorescence upon addition of the
different cationic polymers to DNA. The values are expressed as
percentage of the fluorescence of a solution containing DNA (20 mg / ml)
and EtBr (400 ng / ml). (A) PDMAEMA homopolymers Mw (P1)593
kDa, Mw (P2)5110 kDa, Mw (P3)5166 kDa, Mw (P4)5201 kDa; (B)
imidazole containing copolymers P95P(DMAEMA 0.94 –co-HYMIMMA 0.06 ),
P105P(DMAEMA 0.88 –co-HYMIMMA 0.12 ),
P115
P(DMAEMA 0.81 –co-HYMIMMA 0.19 ), n53.
et al., 1993). The charge ratio at which the fluorescence
signal reaches 50% of the original value (FI 50 ), and the
FI min values are summarised in Table 2. For the
PDMAEMA homopolymers, it can be seen that in the
molecular weight range 93–166 kDa (P1–P3), the FI 50
value is decreasing (Table 2). At a higher molecular
weight (P4, Mw 5201 kDa), the FI 50 value increases again.
These results are in good agreement with those obtained by
the gel retardation experiments, showing there is an
optimum of the molecular weight of the polymers for DNA
condensation (Fig. 2 and Table 2). A similar dependency
of the FI 50 value on the molecular weight of the polymers
was also observed for the P(DMAEMA x –co-HENIMA y )
copolymers containing pyridine groups (P7–P8).
Doubling the amount of imidazole groups, doubles the
FI 50 of the polymers (see P9–P11 in Table 2). For the
copolymers containing methacrylic acid, an analogous
effect was observed: the FI 50 value increases with an
increasing mole% MA (P5–P6).
We also observed an increase in the FI min values for the
PDMAEMA homopolymers, in the molecular weight range
93–165 kDa (P1–P3), while it decreases again for the
homopolymer with the highest molecular weight (P4, 201
kDa). The FI min values of the different copolymers (P5–
P11) are significantly higher than the FI min values of the
PDMAEMA homopolymers (P1–P4), except for the polymer with the highest amount of imidazole functions.
Comparing a stepwise addition with a ‘one shot’ addition of the (co)polymers to a DNA solution, shows that a
stepwise addition results in a better exclusion of EtBr from
the DNA minor groove (Fig. 4).
3.2. Biological evaluation of polymer–DNA complexes
3.2.1. Haemolysis studies
To elucidate possible differences in biological activity
between the polymers, we investigated the haemolytic
216
P. Dubruel et al. / European Journal of Pharmaceutical Sciences 18 (2003) 211–220
Fig. 4. Comparison between a stepwise and a ‘one shot’ addition of a cationic polymer to a solution containing DNA. The values are expressed as
percentage of the fluorescence of a solution containing DNA (20 mg / ml) and EtBr (400 ng / ml), n53, P1: PDMAEMA (Mw 593 kDa), P4: PDMAEMA
(Mw 5201 kDa), P5: P(DMAEMA 0.82 –co-MA 0.18 ), P6: P(DMAEMA 0.65 –co-MA 0.35 ), P7: P(DMAEMA 0.9 –co-HENIMA 0.1 ), P8: P(DMAEMA 0.89 –coHENIMA 0.11 ), P9: P(DMAEMA 0.94 –co-HYMIMMA 0.06 ), P10: P(DMAEMA 0.88 –co-HYMIMMA 0.12 ), n53.
activity of the different polymer–DNA complexes. The
results (Fig. 5) of these tests at a 2 / 1 charge ratio, indicate
that all complexes have a haemolytic activity that is much
lower (1.5–15 times) than PEI. The difference in membrane disrupting activity between PEI and the vinyl
derivatives is even more pronounced at a 4 / 1 charge ratio.
The results further indicate that complexes based on
polymers with pyridine groups (P7), methacrylic acid (P5–
P6) or imidazole groups (P9–P10) have a haemolytic
activity that is lower than PDMAEMA (P4). For the
copolymers containing imidazole or acid functions, the
effect increases with increasing mole% of the corresponding monomers.
3.2.2. Transfection study and cytotoxicity determination
To elucidate possible effects of the introduction of
imidazole groups, pyridine groups or carboxylic acids on
the biological properties of the resulting polymers, the
ability of the different polymers to transfect Cos-1 cells
was investigated. For these tests, PEI (Mw 525 kDa) and
Lipofectamine were used as reference material.
The results for the PDMAEMA homopolymers tested
(P1 and P4) are shown in Table 3. For both polymers, the
transfection efficiency increases with increasing charge
ratio. In this cell line, the polymer with the lowest
molecular weight (P1, Mw 593 kDa) is not able to transfect
cells to a great extent. Complexes based on the polymer
Fig. 5. Haemolytic activity of polymer–DNA complexes at a 2 / 1 charge ratio and at a 4 / 1 charge ratio: P4: PDMAEMA (Mw 5201 kDa), P5:
P(DMAEMA 0.82 –co-MA 0.18 ), P6: P(DMAEMA 0.65 –co-MA 0.35 ), P7: P(DMAEMA 0.9 –co-HENIMA 0.1 ), P9: P(DMAEMA 0.94 –co-HYMIMMA 0.06 ), P10:
P(DMAEMA 0.88 –co-HYMIMMA 0.12 ), n53.
P. Dubruel et al. / European Journal of Pharmaceutical Sciences 18 (2003) 211–220
217
Table 3
b-Gal mass, amount of cell protein and cytotoxicity for the transfection of Cos-1 cells with different polymer–DNA complexes at a 2 / 1 and a 4 / 1 charge
ratio, n53
Code
Polymer
P1
P4
P5
P6
P7
P9
P10
P11
PDMAEMA
PDMAEMA
P(DMAEMA 0.82 –co-MA 0.18 )
P(DMAEMA 0.65 –co-MA 0.35 )
P(DMAEMA 0.9 –co-HENIMA 0.1 )
P(DMAEMA 0.94 –co-HYMIMMA 0.06 )
P(DMAEMA 0.88 –co-HYMIMMA 0.12 )
P(DMAEMA 0.81 –co-HYMIMMA 0.19 )
PEI
Poly(ethyleneimine)
Mw
(kDa)
2/1 charge ratio
93
201
108
316
140
99.5
72
54
25
b-Gal
(ng/ml)
4/1 charge ratio
Cell protein
(mg/ml)
Cell viability
(%)
b-Gal
(ng/ml)
Cell protein
(mg/ml)
Cell viability
(%)
0.02 (60.01)
5.78 (60.63)
0.04 (60.03)
0.02 (60.02)
0.19 (60.05)
0.23 (60.10)
0.06 (60.07)
0.03 (60.02)
36.39 (64.47)
43.30 (61.55)
55.53 (64.13)
57.84 (61.53)
50.53 (63.94)
54.02 (66.85)
63.80 (63.62)
35.5 (62.45)
98
108
103
106
106
109
103
108
(67)
(63)
(65)
(62)
(64)
(63)
(64)
(62)
0.36 (60.03)
19.57 (60.19)
0.04 (60.02)
0.01 (60.01)
5.20 (60.90)
0.12 (60.04)
0.01 (60.01)
1.12 (60.03)
25.98 (66.64)
40.04 (62.38)
52.36 (67.18)
48.70 (63.80)
53.86 (60.83)
46.71 (63.04)
61.81 (64.00)
30.36 (63.87)
101
103
97
102
103
109
100
105
22.34 (61.49)
22.24 (64.89)
79 (66)
9.25 (60.83)
17.64 (61.04)
(66)
(61)
(611)
(67)
(62)
(61)
(64)
(61)
65 (69)
Control (DNA without polymer): b-gal mass 0.08 ng / ml (60.05); amount of cell protein 51.77 mg / ml (65.42). Lipofectamine: b-gal mass 60.10 ng / ml
(622.54); amount of cell protein 19.56 mg / ml (61.83); cell viability 60% (62).
with the highest molecular weight (P4, Mw 5201 kDa) at a
4 / 1 charge ratio, have a b-gal expression level comparable
to PEI–DNA complexes prepared at a 2 / 1 charge ratio
(Table 3). The amount of cell protein (as determined by
the BCA assay) of cells grown for 48 h, after 4 h exposure
to PDMAEMA–DNA (4 / 1 charge ratio) complexes, is
twice that of PEI–DNA (2 / 1 charge ratio) (Table 3). This
is also reflected by the MTT assay in which cells treated
with PEI–DNA (2 / 1 charge ratio) have a lower cell
viability (79%) compared to cells treated with
PDMAEMA–DNA complexes prepared at a 4 / 1 charge
ratio (103%).
The transfection studies also show that the introduction
of imidazole groups (P9–P11), acid functions (P5–P6) or
pyridine groups (P7) has a negative effect on the transfection level. The amount of total protein of cells incubated
with these complexes is 2–3.5 times higher compared to
complexes with PEI (Table 3). Again, the cell viability of
PEI–DNA treated cells is lower compared to polymethacrylate–DNA treated cells.
4. Discussion
In the present paper, we evaluated the physicochemical
and biological properties of methacrylate based polymers
containing tertiary amines, pyridine groups, acidic groups
and imidazole groups as synthetic gene vectors. By using
monomers with varying pKa values, we could obtain
polymers that are partially protonated at physiological pH
and that can be further protonated at endosomal pH
(Dubruel et al., 2000). In this way it is possible to validate
the so-called ‘proton sponge’ theory, proposed by Behr. In
this work, PEI was used as reference material since this
compound is one of the ‘golden standards’ in most
laboratories working on polymeric gene delivery systems.
We believe that the use of this ‘golden standard’ in gene
delivery studies might be useful. In this way comparison
with other studies will be possible, even if the transfection
protocol is somewhat different.
The first step in the evaluation of the different polymers
was the determination of their ability to condense DNA,
using agarose gel electrophoresis and EtBr exclusion tests.
In recent years both techniques have been widely applied
to monitor the DNA condensation process by different
nonviral gene delivery systems (Hsieh et al., 1994; Xu and
Szoka, 1996). Arscott et al. (1990) reported earlier that
DNA condensation occurs if 90% of the anionic charges of
DNA are neutralised. Theoretically, following the definition of the charge ratio, all polymers used in this study
should condense DNA at a 0.9 / 1 charge ratio. The
deviating results for most polymers can be attributed to the
fact that the molecular weight, the dispersity and the
chemical composition of the polymers have an effect on
the DNA condensation. Moreover, not all tertiary amine
groups are necessarily protonated under the conditions of
the experiment.
The results for the PDMAEMA homopolymers, containing only tertiary amine functions, indicate an optimal
molecular weight of the polymer (166 kDa) for DNA
condensation. A similar trend was obtained for the
P(DMAEMA x –co-HENIMA y ) copolymers containing
pyridine groups. At present the reason for this is not clear.
The molecular weight effect of the polymers on DNA
condensation is undoubtedly due to physicochemical polyelectrolyte phenomena. The latter are not yet fully understood but are at present under investigation. To our present
knowledge, there has been no report so far studying the
effect of the molecular weight of cationic polymers on
DNA condensation. Looking at the FI min of the series of
PDMAEMA homopolymers at a 2 / 1 charge ratio (Fig.
3A), it can be seen that although the polymer with the
lowest molecular weight condenses DNA at the highest
charge ratio, the FI min for that polymer is the lowest of all
homopolymers tested. This might be due to a better
interaction of the polymer with the lowest molecular
218
P. Dubruel et al. / European Journal of Pharmaceutical Sciences 18 (2003) 211–220
weight with the condensed DNA, in this way further
expelling EtBr from the DNA minor groove.
In addition to this molecular weight effect, we also
observed an effect of the chemical composition of the
polymers on their DNA condensing properties. For the
imidazole containing copolymers P(DMAEMA x –co-HYMIMMA y ), the charge ratio for DNA condensation increases with increasing amount of imidazole groups (Table
2). Although the amount of charges at a certain charge
ratio is identical, the distance between two positively
charged tertiary amine functions in a copolymer containing
tertiary amines and imidazole functions, is larger compared
to that in the PDMAEMA homopolymers. This increased
charge separation makes DNA condensation less favourable. This effect increases with an increasing amount of
imidazole groups. A similar effect was observed earlier for
a series of poly(amidoamines) (Jones et al., 2000). Comparing the FI min values of the different imidazole containing copolymers (Fig. 3A and B, Table 2) with those
obtained for the homopolymers, we observed that the FI min
values are higher for the imidazole containing copolymers.
This is another indication that polymers with a higher
amount of imidazole groups interact less with DNA.
For the polymers containing acid functions, a similar
effect in FI min was observed (Table 2). For this type of
polymer, the results can be explained by the presence of
negatively charged carboxylate groups, causing electrostatic repulsion with anionic DNA. This is confirmed by
the increase of the charge ratio for DNA condensation,
with an increasing amount of acid functions.
The effect of an increasing amount of pyridine groups
could not be investigated because polymers with a higher
amount of pyridine groups (.15 mole%) are water-insoluble.
A stepwise addition of polymer to DNA, results in a
better exclusion of EtBr from the DNA minor groove than
a ‘one shot’ addition. Probably a stepwise addition enables
a better orientation of and a better interaction between both
charged molecules.
Thus, the DNA condensation studies showed that the
ability of the different polymers to condense DNA is
strongly affected by the chemical composition and the
molecular weight of the polymers. In order to investigate a
possible correlation between the composition and / or the
molecular weight of the polymers and their biological
properties, we carried out a series of biological studies
including in vitro transfection studies, cell viability determination and haemolysis studies. These studies were
carried out at two different charge ratios (2 / 1 and 4 / 1)
since preliminary experiments have shown that the optimal
transfection efficiency of these polymers ranges between a
2 / 1 and a 4 / 1 charge ratio (Schacht et al., 2000). In that
work, charge ratios ranging from 0.25 / 1 to 32 / 1 were
evaluated. In addition, at charge ratios higher than 4 / 1, the
toxicity of PEI and some of the polymers used in this study
increases drastically, what makes the use of these charge
ratios less favourable.
The transfection studies showed that the PDMAEMA
with the highest molecular weight has a b-gal expression
level similar to that of PEI, although the optimum is
reached at a higher charge ratio (4 / 1 for PDMAEMA
versus 2 / 1 for PEI). The homopolymer with the lowest
molecular weight is not able to transfect Cos-1 cells. This
molecular weight dependent transfection efficiency was
reported earlier for a series of nonviral gene delivery
systems including PLL, PEI, chitosan and other vinyl
derivatives (Godbey et al., 2001; Sato et al., 2001). After 4
h incubation of the cells with polymer–DNA complexes,
the PDMAEMA homopolymers have a lower cytotoxicity
than PEI (respectively, 103% versus 79%). After 48 h
growth, PDMAEMA have an amount of cell protein that is
twice that of PEI (Table 3). Gebhart and Kabanov (2001)
have shown earlier that the amount of cell protein and the
cell viability are related to each other. Thus, our results
indicate a toxic effect of PEI.
The transfection efficiency of the pyridine containing
P(DMAEMA 0.9 –co-HENIMA 0.1 ) copolymer at a 4 / 1
charge ratio, is lower compared to the PDMAEMA
homopolymer. The molecular weight of this copolymer is
lower compared to the homopolymer PDMAEMA. Probably the reduced transfection efficiency is due to a combination of the introduction of pyridine groups and the lower
molecular weight of the polymer. The polymers containing
imidazole functions (HYMIMMA) or acid functions (MA)
are not able to transfect Cos-1 cells. However, determination of cytotoxicity (after 4 h transfection) and of the
amount of cell protein (after 48 h growth) revealed that
these polymethacrylate–DNA complexes are less toxic
than PEI–DNA complexes.
Combination of these results with those from the
haemolysis studies shows a clear correlation between the
cell viability and the haemolytic activity of the different
polymer–DNA complexes and their transfection potential.
Although the membranes of red blood cells and cells in
culture are structurally different, they both possess a net
negative charge. It can thus be anticipated that complexes
showing a higher degree of haemolysis, can interact to a
larger extent with Cos-1 cells, in this way enabling
complexes to be taken up more efficiently into cells by
endocytosis, resulting in a higher transfection efficiency.
Moreover, haemolysis studies are clinically relevant, since
for in vivo applications, red blood cells are one the first
type of cells the complexes will interact with.
5. Conclusions
In the present study, a number of cationic polymers were
evaluated as vectors for gene delivery. The DNA condensation studies showed that minor modifications of the
chemical composition or the molecular weight of the
polymers induce major effects on the DNA condensation
patterns. Accurate selection of the monomers used, enables
us to obtain polymers with differing DNA condensing
P. Dubruel et al. / European Journal of Pharmaceutical Sciences 18 (2003) 211–220
properties. The transfection studies showed that
PDMAEMA with a molecular weight of 201 kDa has a
transfection efficiency that is similar to PEI, while it is
nontoxic to Cos-1 cells. Polymers containing imidazole
groups, acid functions or pyridine groups are not able to
transfect Cos-1 cells, while their toxicity and haemolytic
activity is lower than the PDMAEMA homopolymer.
Thus, these poly(methacrylate)–DNA systems are a
strong potential tool for gene delivery as they show a
lower toxicity and haemolytic activity compared to PEI.
Some of the polymers used in this study show buffering
properties in the pH range of the endosomes (pH 5.5–7.4),
in analogy with the ‘PEI proton sponge’. However, this
work indicates that these buffering properties of the
synthetic polymers are not necessarily the decisive element
in the transfection process, as the polymers containing
imidazole groups or acid functions have a lower transfection capacity, probably due to a restricted cell uptake. In
this context a more detailed study on the membrane
interaction properties and the intracellular trafficking of the
polymer–DNA complexes is needed.
Acknowledgements
The authors would like to thank the Flemish Institute for
the promotion of Scientific-Technological Research in
Industry (IWT), the fund for Scientific Research Flanders
(FWO), the Belgian Ministry of Scientific Programming,
IUAP/ PAI-IV/ 11. The group of Xaveer Van Ostade is
greatly acknowledged for supplying us with the E. Coli
and for the electroporation.
References
Abdallah, B., Hassan, A., Benoist, C., Goula, D., Behr, J.P., Demeneix,
B.A., 1996. A powerful nonviral vector for in vivo gene transfer into
the adult mammalian brain: poly(ethyleneimine). Hum. Gene Ther. 7,
1947–1954.
Arigita, C., Zuidam, N.J., Crommelin, D.J.A., Hennink, W.E., 1999.
Association and dissociation characteristics of polymer / DNA complexes used for gene delivery. Pharmaceut. Res. 16 (10), 1534–1541.
Arscott, P.G., Li, A.Z., Bloomfield, V.A., 1990. Condensation of DNA by
trivalent cations. 1. Effects of DNA length and topology on the size
and shape of condensed particles. Biopolymers 30, 619–630.
Behr, J.P., 1997. The proton sponge: a trick to enter cells the viruses did
not exploit. Chimia 51, 34–36.
Brock, T.D., Madigan, M.T., Martinko, J.M., Parker, J., 1994. Biology of
Microorganisms, 7th Edition. Prentice Hall.
Cherng, J.Y., van de Wetering, P., Talsma, H., Crommelin, D.J.A.,
Hennink, W.E., 1997. Freeze-drying of poly((2-dimethylamino)ethyl
methacrylate)-based gene delivery systems. Pharmaceut. Res. 14 (12),
1838–1841.
Dekie, L., Toncheva, V., Dubruel, P., Schacht, E.H., Barret, L., Seymour,
L.W., 2000. Poly-L-glutamic acid derivatives as vectors for gene
therapy. J. Control. Release 65, 187–202.
Dubruel, P., Schacht, E.H., 2000. Effect of polyethylene oxide blocks or
grafts on the physicochemical properties of poly(2-N-(dimethylaminoethyl)methacrylate)–DNA complexes. J. Bioact. Compat.
Pol. 15 (4), 279–298.
219
Dubruel, P., Toncheva, V., Schacht, E.H., 2000. pH sensitive vinyl
polymers as vectors for gene delivery. J. Bioact. Compat. Pol. 15 (3),
191–213.
Erbacher, P., Roche, A.C., Monsigny, M., Midoux, P., 1995. Glycosylated
polylysine–DNA complexes: gene transfer efficiency in relation with
the size and the sugar substitution level of glycosylated polylysines
and with the plasmid size. Bioconj. Chem. 6, 401–410.
Fasbender, A., Zabner, J., Chillon, M., Moninger, T.O., Puga, A.P.,
Davidson, B.L., Welsh, M.J., 1997. Complexes of adenovirus with
polycationic polymers and cationic lipids increase the efficiency of
gene transfer in vitro and in vivo. J. Biol. Chem. 272 (10), 6479–
6489.
Felgner, P.L., 1990. Particulate systems and polymers for in vitro and in
vivo delivery of polynucleotides. Adv. Drug Deliv. Rev. 5, 163–187.
Felgner, P.L., Gadek, T.R., Holm, M., Roman, R., Chan, H.W., Wenz, M.,
Northrop, J.P., Ringold, G.M., Danielsen, M., 1987. Lipofection-A
highly efficient, lipid-mediated DNA-transfection procedure. Proc.
Natl. Acad. Sci. USA 86, 6077–6081.
Gebhart, C.L., Kabanov, A.V., 2001. Evaluation of polyplexes as gene
transfer agents. J. Control. Release 73 (2-3), 401–416.
Gershon, H., Ghirlando, R., Guttman, S.B., Minsky, A., 1993. Mode of
formation and structural features of DNA cationic liposome complexes
used for transfection. Biochemistry 32, 7143–7151.
Godbey, W.T., Wu, K.K., Mikos, A.G., 1998. Size matters: molecular
weight affects the efficiency of poly(ethyleneimine) as a gene delivery
vehicle. J. Biomed. Mater. Res. 45, 268–275.
Godbey, W.T., Wu, K.K., Mikos, A.G., 2001. Poly(ethyleneimine)-mediated gene delivery affects endothelial cell function and viability.
Biomaterials 22, 471–480.
Hay, J.G., McElvaney, N.G., Herena, J., Chrystal, R.G., 1995. Modification of nasal epithelial potential differences of individuals with
cystic-fibrosis consequent to local administration of a normal CFTR
CDNA adenovirus gene transfer vector. Hum. Gene Ther. 6, 1487–
1496.
Hashida, M., Takemura, S., Nishikawa, M., Takakura, Y., 1998. Targeted
delivery of plasmid DNA complexed with galactosylated poly( Llysine). J. Control. Release 53, 301–310.
Hinrichs, W.L.J., Schuurmans-Nieuwenbroek, N.M.E., van de Wetering,
P., Hennink, W.E., 1999. Thermosensitive polymers as carriers for
DNA delivery. J. Control. Release 60, 249–259.
Howard, K.A., Dash, P.R., Read, M.L., Ward, K., Tomkins, L.M.,
Nazarova, O., Ulbrich, K., Seymour, L.W., 2000. Influence of hydrophilicity of cationic polymers on the biophysical properties of polyelectrolyte complexes formed by self-assembly with DNA. Biochim.
Biophys. Acta 1475, 245–255.
Hsieh, H.P., Muller, J.G., Burrows, C.J., 1994. Structural effects in novel
steroidal polyamine–DNA binding. J. Am. Chem. Soc. 116, 12077–
12078.
Janes, K.A., Calvo, P., Alonso, M.J., 2001. Polysaccharide colloidal
particles as delivery systems for macromolecules. Adv. Drug Deliv.
Rev. 47, 83–97.
Jolly, D., 1994. Viral vector systems for gene-therapy. Cancer Gene Ther.
1, 51–64.
Jones, N.A., Hill, I.R.C., Stolnik, S., Bignotti, F., Davis, S.S., Garnett, F.,
2000. Polymer chemical structure is a key determinant of physicochemical and colloidal properties of polymer–DNA complexes for
gene delivery. Biochim. Biophys. Acta 1517, 1–18.18.
Kim, J.S., Kim, B.L.L., Maruyama, A., Akaike, T., Kim, S.W., 1998. A
new nonviral DNA delivery vector: the terplex system. J. Control.
Release 53, 175–182.
Mullen, P.M., Lollo, C.P., Phan, Q.C., Amini, A., Banaszczyk, M.G.,
Fabrycki, J.M., Wu, D., Carlo, A.T., Pezolli, P., Coffin, C.C., Carlo,
D.J., 2000. Strength of conjugate binding to plasmid DNA affects
degradation rate and expression level in vivo. Biochim. Biophys. Acta
1519, 103–110.
Pouton, C.W., Seymour, L.W., 2001. Key issues in nonviral gene delivery.
Adv. Drug Deliv. Rev. 46, 187–203.
Richardson, S.C.W., Kolbe, H.V.J., Duncan, R., 1999. Potential of low
220
P. Dubruel et al. / European Journal of Pharmaceutical Sciences 18 (2003) 211–220
molecular mass chitosan as a DNA delivery system: biocompatibility,
body distribution and ability to complex and protect DNA. Int. J.
Pharm. 178, 231–243.10.
Sato, T., Ishii, T., Okahata, Y., 2001. In vitro gene delivery mediated by
chitosan. Effect of pH, serum and molecular mass of chitosan on the
transfection efficiency. Biomaterials 22, 2075–2080.
Schacht, E., Toncheva, V., Dekie, L., Dubruel, P. 2000. Synthetic
polymers as vectors for gene delivery. Abstracts of papers of the
American Chemical Society 220:14-Poly, Part 2 August 20 2000.
Straubinger, R.M., Paphadjopoulos, D., 1983. Liposomes as carriers for
intracellular delivery of nucleic-acids. Method. Enzymol. 101, 512–
527.
Szoka, Jr. F., Papahadjopoulos, D., 1978. Proc. Natl. Acad. Sci. USA 75,
4194–4198.
Wagner, E., Cotten, M., Foisner, R., Birnstiel, M.L., 1991. Transferrin
polycation DNA complexes—The effect of polycations on the struc-
ture of the complex and DNA delivery to cells. Proc. Natl. Acad. Sci.
USA 88, 4225–4259.
Wu, G.Y., Wu, C.H., 1987. Receptor-mediated in vitro gene transformation by a soluble DNA carrier system. J. Biol. Chem. 262 (10),
4429–4432.
Xu, Y.H., Szoka, F.C., 1996. Mechanism of DNA release from cationic
liposome–DNA complexes used in cell transfection. Biochemistry 35,
5616–5623.
Zabner, J., Couture, L.A., Gregory, R.J., Graham, S.M., Smith, A.E.,
Welsh, M.J., 1993. Adenovirus-mediated gene-transfer transiently
corrects the chloride transport defect in nasal epithelia of patients with
cystic fibrosis. Cell 75, 207–216.
Zhou, X.H., Klibanov, A.L., Huang, L., 1991. Lipophilic polylysines
mediate efficient DNA transfection in mammalian cells. Biochim.
Biophys. Acta 1065 (1), 8–14.
Biomacromolecules 2004, 5, 379-388
379
Buffering Properties of Cationic Polymethacrylates Are Not the
Only Key to Successful Gene Delivery
Peter Dubruel,† Bart Christiaens,‡ Maryvonne Rosseneu,‡ Joël Vandekerckhove,‡,§
Johan Grooten,| Vera Goossens,|,⊥ and Etienne Schacht*,†,#
Polymer Materials Research Group, Department of Organic Chemistry, Ghent University, Ghent, Belgium,
Laboratory for Lipoprotein Chemistry, Department of Biochemistry, Ghent University, Ghent, Belgium,
Flanders Interuniversity Institute for Biotechnology (VIB), Department of Medical Protein Research,
Ghent University, Ghent, Belgium, Department of Molecular Biomedical Research,
Molecular Immunology Unit, Flanders Interuniversity Institute for Biotechnology and Ghent University,
Institute for Biomedical Technology (IBITECH), Ghent University, Ghent, Belgium
Received October 30, 2003; Revised Manuscript Received December 7, 2003
Recently, we have shown that polymethacrylates containing imidazole side groups (HYMIMMA) or acid
functions (MA), which have similar buffering properties as polyethyleneimine, were not able to transfect
Cos-1 cells, whereas polymers containing only tertiary amines (DMAEMA) do transfect Cos-1 cells (Dubruel,
P. et al. Eur. J. Pharm. Sci. 2003, 18 (3-4), 211-220). In the present work, we investigated to what extent
the differences in transfection activity are related to differences in cellular internalization and/or subcellular
localization. Therefore, we synthesized a series of polymethacrylates containing primary amine functions,
used for the coupling of the fluorescent Oregon Green probe. The polymers containing acid functions were
labeled with an amine containing fluorescein derivative (5-aminomethyl)fluorescein hydrochloride. It is
demonstrated that the endosomal release of the MA and HYMIMMA-based complexes might be the limiting
step in the gene transfer process in Cos-1 cells.
1. Introduction
In the last two decades, gene delivery has attracted
considerable interest as a possible therapy for the treatment
of diseases caused by genetic defects.1-3 One of the
advantages of this therapy is its potential application for the
treatment of acquired diseases such as cancer and AIDS. In
a classical gene delivery protocol, DNA, the carrier of the
genetic information, is used as a drug for corrective treatment.
Since spontaneous DNA internalization is hampered by its
physicochemical properties (i.e., a negative charge and a large
hydrodynamic volume4), it has to be combined with a vector.
Virusses have the natural ability to infect cells and their use
as biological gene delivery systems seems straightforward.5
However, the different types of virusses (retrovirusses,
adenovirusses, adeno-associated virusses, ...) suffer several
drawbacks depending on the type of viral vector used.6-7
Alternative DNA vectors are the nonviral vectors covering
both liposomal and polymeric gene delivery systems. These
two systems have in common that DNA condensation occurs
through electrostatic interaction between the negative charges
* To whom correspondence should be addressed. Address: Krijgslaan
281 (S4 Bis), B-9000 Ghent, Belgium. Tel.: 0032-(0)9-2644497. Fax.:
0032-(0)9-2644998. E-mail: [email protected].
† Department of Organic Chemistry.
‡ Department of Biochemistry.
§ Department of Medical Protein Research.
| Flanders Interuniversity Institute for Biotechnology and Ghent University.
⊥ Current adress: Innogenetics, Therapeutics R&D, Industriepark 7, 9052
Zwijnaarde, Belgium.
# Institute for Biomedical Technology (IBITECH).
of the DNA phosphate groups and the positive charges of
the amine containing liposomes or polymers.8-9 A large
number of research groups, including our own, have focused
on the synthesis and evaluation of cationic polymers as gene
delivery systems.10-15,27-30 Polymers have the advantage that
a large variety of functional groups can be introduced by an
accurate monomer selection or by polymer functionalization.
In addition, large scale production of polymers is feasible,
opening perspectives for industrial exploitation. However,
at present, polymeric gene delivery systems have not yet met
the high expectations (cell specific high transfection efficiency and low cytotoxicity) despite the large number of
polymers that have been evaluated as gene carriers in recent
years: poly-L-lysine16-18 and other poly-R-amino acids,19-20
polyethyleneimine (PEI)21-23 and its derivatives,24-25 poly(2-N,N-(dimethylaminoethyl) methacrylate)26 (PDMAEMA)
and DMAEMA based (block)-copolymers,27-31 gelatin,32,33
and polyphosphazenes.34 PEI has a high transfection efficiency in a large number of cell lines. A possible explanation for the good transfection properties of PEI is the socalled “proton sponge theory”, proposed by Behr et al.35 This
theory is based on the fact that PEI undergoes further
protonation when PEI-DNA complexes are localized in the
endosomal compartment. To maintain the endosomal pH,
proton pumps in the endosomal membrane, are transferring
protons (and chloride counterions) into the endosomes. This
transfer leads to an osmotic effect resulting in a swelling of
the endosomes. Finally, this would result in a rupture of the
endosomes. In addition to this osmotic effect, further PEI
10.1021/bm034438d CCC: $27.50
© 2004 American Chemical Society
Published on Web 01/15/2004
380
Biomacromolecules, Vol. 5, No. 2, 2004
protonation would also result in an expansion of the polymer
(and thus the complexes) due to internal charge repulsion.
Both synergistic effects are thought to shorten the endosomal
lifetime drastically. However, at present, there is some
controversy regarding the validity of this theory. In addition,
PEI-DNA complexes possess a high cytotoxicity and
haemolytic activity.30
Therefore, we synthesized polymethacrylates with similar
transfection efficiency and lower toxicity compared to
PEI.27,29-30 We showed that these polymers condense DNA
and that copolymers containing tertiary amines (DMAEMA)
and acid functions (MA) and copolymers containing DMAEMA and imidazole functions (HYMIMMA) are not able to
transfect cells in vitro.30 In the present work, we want to
elucidate the mechanisms underlying these findings by
studying the cellular internalization and localization of a
series of fluorescently labeled polymer-DNA complexes by
confocal microscopy.
2. Materials and Methods
2.1. Chemicals. Ethanolamine, linear calf thymus DNA
(15-23 kb), boric acid, bromophenol blue, and agarose
(electrophoresis grade) were from Sigma (Bornem, Belgium).
Ethanolamine was distilled before use. EDTA and 2-N,N(dimethylaminoethyl) methacrylate (DMAEMA) were purchased from Fluka (Bornem, Belgium). DMAEMA was
distilled before use. Glycerol was from Vel (Leuven,
Belgium). Di-tert-butyl dicarbonate, methacrylic anhydride,
2,2′-azobis(2-methyl-propionitrile), calcium hydride, and
triethylamine were purchased from Acros (Geel, Belgium).
All chemicals, except triethylamine which was distilled, were
used as received. Branched polyethyleneimine (Mw ) 25 000
g/mol), EDC, MTT, and trifluoro acetic acid were from
Aldrich (Bornem, Belgium) and were used as received.
Lysotracker Red DND-99, Oregon Green 488-X succinimidyl
ester, and 5-(aminomethyl)fluorescein hydrochloride were
obtained from Molecular Probes (Leiden, The Netherlands)
and were used as received. Toluene, the solvent used for
the polymerization reactions, was dried over calcium hydride
and distilled before use. Penicillin, Streptomycin, Lipofectamine, and DMEM were obtained from Gibco BRL (Life
Technologies) (Merelbeke, Belgium). pCMVbeta plasmid
(7.2 kb) was obtained from Clontech (Erembodegem,
Belgium). FBS was obtained from Perbio (Helsingborg,
Sweden). The β-gal ELISA kit was obtained from Roche
(Vilvoorde, Belgium). The BCA Protein Assay kit was
obtained from Pierce (Erembodegem, Belgium). The endotoxin-free plasmid Maxiprep kit was obtained from Qiagen
(Leusden, The Netherlands). The water used throughout this
study was double distilled.
2.2. Monomer Synthesis. 2.2.1. Synthesis of t-Boc Protected 4-Methyl-5-imidazoyl Methyl Methacrylate. To a
solution of 4-methyl-5-imidazoyl methanol hydrochloride
(1.5 g, 11.15 mmol) in dioxane (20 mL) and H2O (10 mL)
was added 0.1 N NaOH (12 mL, 24 mmol) and di-tert-butyl
dicarbonate (2.4 g, 11 mmol). The reaction mixture was
cooled in an ice bath and stirred for 24 h under N2
atmosphere. The solution was then concentrated to 15 mL
Dubruel et al.
by evaporation of the solvent under reduced pressure. The
aqueous phase was saturated with NaCl and extracted three
times with EtAc. After drying over MgSO4, the solvent was
evaporated under reduced pressure. t-Boc protected 4-methyl5-imidazoyl methanol was isolated after addition of cold
pentane (40 mL). The product was filtered off, washed three
times with pentane, and dried under reduced pressure for 24
h.
To a solution of t-Boc protected 4-methyl-5-imidazoyl
methanol (10.65 g, 50 mmol) and phenothiazine (20 mg, 0.1
mmol) in CH2Cl2 (30 mL) was added Et3N (7.0 mL, 50
mmol). The reaction mixture was cooled in an ice bath, and
methacryloyl chloride (6.5 mL, 66.53 mmol) was added. The
reaction was stirred for 1 h under N2 atmosphere and then
poured into H2O (100 mL). The product was extracted with
ether. The organic phase was washed three times with a
saturated NaHCO3 and dried over MgSO4. After addition of
phenothiazine (to avoid premature polymerization), the
monomer was obtained as an oil by evaporation of the
solvent under reduced pressure. The chemical structure was
determined by 1H NMR spectroscopy.
1
H NMR: (500 MHz, CDCl3) δ ) 8.1 and 8.0 ppm
(imidazole proton), δ ) 6.2 ppm, 6.1, 5.8, and 5.55 ppm
(CH2dC), δ ) 5.3 and 5.1 ppm (CH2-O), δ ) 2.45 and
2.35 ppm (CH3 on imidazole), δ ) 1.9 ppm (CH3-C), δ )
1.5 and 1.6 ppm ((CH3)3-C).
2.2.2. Synthesis of t-Boc Protected Aminoethyl Methacrylate. To an ice-cooled solution of ethanolamine (3 mL, 50.7
mmol) in CH2Cl2 (30 mL) was added a solution of di-tertbutyl dicarbonate (9.23 g, 42 mmol) in CH2Cl2 (15 mL)
under continuous stirring. The reaction was left stirring
overnight at room temperature. Then, the reaction mixture
was extracted one time with a 10% KHSO4 solution and two
times with water. After drying the organic phase over
MgSO4, t-Boc protected ethanolamine was isolated as an
tranparent oil after evaporation of the solvent under reduced
pressure. The chemical structure was confirmed by 1H NMR
spectroscopy.
1
H NMR: (500 MHz, CDCl3) δ ) 5.0 ppm (NH-CdO),
δ ) 3.8 ppm (CH2-O), δ ) 3.25 ppm (CH2-N), δ ) 2.4
ppm (CH2-OH), δ ) 1.5 ppm ((CH3)3-C).
In a subsequent step, triethylamine (3.1 mL, 22 mmol)
was added to an ice-cooled solution of t-Boc protected
ethanolamine (3.55 g, 22 mmol) in CH2Cl2. To this was
added a solution of methacrylic anhydride (3.9 mL, 24 mmol)
in CH2Cl2 (5 mL). After stirring overnight at room temperature, the reaction mixture was extracted three times with a
10% NaHCO3 solution and one time with water. After drying
the organic phase over MgSO4, the solvent was partially
removed under reduced pressure. t-Boc protected aminoethyl
methacrylate was isolated after precipitation in ice-cooled
pentane. After filtration, the product was washed three times
with pentane and dried for 24 h under reduced pressure. The
chemical structure of the monomer was determined by 1H
NMR spectroscopy.
1
H NMR: (500 MHz, CDCl3) δ ) 6.1 and 5.6 ppm (CH2d
C), δ ) 4.8 ppm (NH-CdO), δ ) 4.2 ppm (CH2-O), δ )
3.4 ppm (CH2-N), δ ) 1.9 ppm (CH3-C), δ ) 1.5 ppm
((CH3)3-C).
Keys to Successful Gene Delivery
Biomacromolecules, Vol. 5, No. 2, 2004 381
Figure 1. Synthesis scheme of P(DMAEMA0.48-co-AEMA0.42-co-HYMIMMA0.10). t-Boc-AEMA, t-Boc-HYMIMMA, and DMAEMA were polymerized
for 24 h in toluene at 65 °C using AIBN as the radical initiator.
2.3. Polymer Synthesis. 2.3.1. Synthesis of PDMAEMA
and P(DMAEMA0.65-co-MA0.35). The synthesis of poly(2-N,N(dimethylaminoethyl) methacrylate), PDMAEMA, and poly(2-N,N-(dimethylaminoethyl) methacrylate0.65-co-methacrylic
acid0.35), P(DMAEMA0.65-co-MA0.35), was described before.
As an example, the synthesis of PDMAEMA will be given.
To a solution of DMAEMA (5 g; 29.67 mmol) in dry toluene
(20 mL) was added 319 µl (3.19 mg/19.4 µmol) of a AIBN
stock solution (10 mg/mL) in toluene. The solution was
degassed three times and then heated to 65°C. The reaction
mixture was left stirring at 65 °C for 24 h under N2 atmosphere. Next the PDMAEMA homopolymer was precipitated
in 200 mL of ice-cooled pentane, filtered, and washed. The
polymer was then redissolved in 0.1 N HCl and dialyzed
during 48 h against water. Finally, the polymer was obtained
by freeze-drying. The chemical structure of the polymer
obtained was determined by 1H NMR spectroscopy.
2.3.2. Synthesis of P(DMAEMA0.96-co-AEMA0.04) and P(DMAEMA0.48-co-AEMA0.42-co-HYMIMMA0.10). The synthesis of P(DMAEMA0.96-co-AEMA0.04) and P(DMAEMA0.48co-AEMA0.42-co-HYMIMMA0.10) was carried out in a similar
way as described in section 2.3.1 and in ref 27. As an
example, the synthesis of P(DMAEMA0.48-co-AEMA0.42-coHYMIMMA0.10) is described below. The general reaction
scheme is shown in Figure 1.
t-Boc protected HYMIMMA (303.5 mg, 1.084 mmol),
DMAEMA (365 µL, 2.168 mmol) and t-Boc protected
AEMA (496 mg, 2.168 mmol) were dissolved in 7 mL of
dry toluene. The solution was degassed 3 times before
polymerization. Finally, AIBN (0.4688 mg, 2.85 µmol) was
added as a radical initiator. After 24 h at 65 °C under nitrogen
atmosphere, the polymer was isolated by precipitation in icecooled pentane. The polymer was filtered and washed three
times with pentane. The t-Boc protecting group from the
HYMIMMA and AEMA units was removed by acidolysis
in trifluoro acetic acid as described earlier (for a detailed
protocol, see ref 27). The chemical composition of the
polymer was determined by 1H NMR spectroscopy, taking
into account the characteristic peaks from the different
monomers used. The composition of all polymers used in
the present study is shown in Table 1. The chemical structure
of the compounds is given in Figure 2.
382
Biomacromolecules, Vol. 5, No. 2, 2004
Dubruel et al.
Table 1. Chemical Composition, Molecular Weight, Refractive Index Increment, Polydispersity, and Mass Per Charge of the Cationic
Polymers Used in This Worka
chemical composition
weight average
molecular weight (g/mol)
refractive
index increment
polydispersity
(Mw/Mn)
mass/charge
(g/mol)
mol %
fluorophore
PDMAEMA
P(DMAEMA0.96-co-AEMA0.04)
P(DMAEMA0.48-co-AEMA0.42-co-HYMIMMA0.10)
P(DMAEMA0.65-co-MA0.35)
PEI
201 000
273 000
47 000
316 000b
25 000
0.201
0.162
0.163
0.155
0.282
1.4
1.7
2.4
194
193
201
520
208
0.7
1.7
0.4
0.5
2.0
a
Finally, the coupling efficiency of Oregon Green to P(DMAEMA0.96-co-AEMA0.04), P(DMAEMA0.48-co-AEMA0.42-co-HYMIMMA0.10), and PEI and the
coupling efficiency of 5-(aminomethyl)fluorescein hydrochloride to P(DMAEMA0.65-co-MA0.35) are also given. b The molecular weight of P(DMAEMA0.65co-MA0.35) was not determined by gel permeation chromatography due to adsorption phenomena on the GPC column. Therefore, the molecular weight
of this polymer was determined by static light scattering as reported earlier (see ref 30).
Figure 2. Chemical structure of the different polymethacrylates and fluorophores used in this work.
2.4. Molecular Weight Determination. The molecular
weight of the polymers was determined by gel permeation
chromatography (GPC) on an Ultrahydrogel-1000 column
(7.8 mm × 300 mm) from Waters. The eluent used was a
phosphate buffer (5% NaH2PO4, 3% acetonitrile, pH ) 4).
The flow rate was 0.750 mL/min. GPC analysis was
performed at concentrations of 10-15 mg/mL. The detector
was a combination of a differential refractometer (Waters)
and a MALLS light scattering detector (Meyvis). The
refractive index of all polymers was first determined with a
double beam differential refractometer (DRM 1020, Polymer
Laboratories). The molecular weight, the polydispersity, and
the refractive index increment of all polymers used in this
study are presented in Table 1.
2.5. Coupling of Oregon Green to P(DMAEMA0.96-coAEMA0.04), P(DMAEMA0.48-co-AEMA0.42-co-HYMIMMA0.10) and PEI. The coupling of Oregon Green to
P(DMAEMA0.96-co-AEMA0.04), P(DMAEMA0.48-co-AEMA0.42-co-HYMIMMA0.10) and PEI was carried out in a
similar way. The general protocol for the different polymers
is given below.
The polymer (20 mg) was dissolved in 0.2 mL pf NaHCO3
buffer (pH ) 8.3). To this solution was added dropwise an
amount of Oregon Green (dissolved in DMF) under continu-
Biomacromolecules, Vol. 5, No. 2, 2004 383
Keys to Successful Gene Delivery
Table 2. DNA Condensation Properties as Studied by Agarose
Gel Electrophoresisa
chemical composition
charge ratio (()
PDMAEMA
P(DMAEMA0.96-co-AEMA0.04)
P(DMAEMA0.48-co-AEMA0.42-co-HYMIMMA0.10)
P(DMAEMA0.65-co-MA0.35)
PEI
1.6/1
1.2/1
1.4/1
1.6/1
0.4/1
a Polymer-DNA complexes were prepared at different charge ratios
and applied on a 1% agarose gel. The DNA in the gels was stained by
incubating the gel in an EtBr solution (0.5 µg/mL) for 1 h.
ous stirring. The amount of Oregon Green used corresponds
to a maximum conversion of 2 mol % of the primary amines.
After reacting for 1 h in the dark, the reaction mixture was
dialyzed against 1 M NaCl to remove any unreacted Oregon
Green. Any residual Oregon Green in the dialysis water
(outer part) was detected by UV (absorbance measurements
at 496 nm). Finally, the product was dialyzed against water
to remove traces of NaCl. The product was obtained by
freeze-drying. The amount of fluorophore coupled was
determined by UV (496 nm). The coupling efficiency for
the different polymers are summarized in Table 1.
2.6. Coupling of 5-(Aminomethyl)fluorescein Hydrochloride to P(DMAEMA0.65-co-MA0.35). 65 mg of P(DMAEMA0.65-co-MA0.35) was dissolved in 0.5 mL of phosphate buffer (pH ) 7). To this solution was added dropwise
a solution of 2.5 mg of 5-(aminomethyl)fluorescein hydrochloride (in 250 µL DMF) under continuous stirring. The
amount of fluorophore added corresponds to a maximum
conversion of 3.25 mol % of the acid functions. After 15
min, 8 mg of EDC was added. After reacting for 2 h in the
dark, the reaction mixture was dialyzed against 1 M NaCl
to remove any unreacted 5-(aminomethyl)fluorescein hydrochloride. Residual 5-(aminomethyl)fluorescein hydrochloride in the dialysis water (outer part) was detected by
UV absorbance at 492 nm. Finally, the product was dialyzed
against water to remove traces of NaCl. The product was
obtained by freeze-drying. The amount of fluorophore
coupled was determined by UV (492 nm).
2.7. Complex Formation and DNA Condensation Studies. The charge ratio is defined as the number of cationic
charges of the polymer to the number of anionic charges
from DNA. For the calculation of the charge ratio, a mass
per charge of 325 Da was used for DNA. The mass per
charge of all cationic polymers was calculated assuming that,
under the experimental conditions, only the amine functions
Figure 3. DNA condensation pattern of P(DMAEMA0.48-co-AEMA0.42co-HYMIMMA0.10) (left part of the gel) and P(DMAEMA0.96-coAEMA0.04) (right part of the gel). The polymer-DNA complexes were
prepared at different charge ratios and applied on a 1% agarose gel.
DNA staining was performed by incubating the gel in a 5 µg/mL EtBr
solution.
of the side groups with the highest pKa (DMAEMA) are
protonated. The acid groups (MA) are nonprotonated and
thus negatively charged, whereas the imidazole groups are
supposed to be nonprotonated and thus neutral. The values
of the mass per charge for the different polymers are shown
in Table 1. For PEI, a mass per charge of 208 Da was used.
The DNA condensation properties of the polymers were
evaluated by agarose gel electrophoresis. Polymer-DNA
complexes were prepared in water at different charge ratios,
ranging from 0.2/1 to 3/1 (() using linear calf thymus DNA,
as described earlier.29-30 The results are shown in Table 2
and Figure 3.
2.8. Transfection and Toxicity Studies. The transfection
efficiency of the polymers in the monkey kidney fibroblast
Cos-1 cell line was studied using the pCMVbeta plasmid,
encoding β-galactosidase controlled by the CMV promotor,
as described earlier.30
The transfection mixtures, containing the polymer-DNA
complexes, were prepared as follows. Three compounds were
added and mixed in a precise order: DNA, water, and
polymer. The final volume of the mixtures was 80 µL,
containing 0.06 mg/mL plasmid DNA and the appropriate
amount of polymer to obtain the desired charge ratio. The
quantification of the β-gal mass was performed using a β-gal
ELISA kit. Cellular protein determinations were performed
with the BCA Protein Assay kit.
The cytotoxicity of all polymer-DNA complexes was
determined by means of the MTT assay as described earlier.30
All data (Table 3) are reported as mean ( standard deviation
for triplicate samples. The results represent the toxicity of
Table 3. β-gal Mass and Amount of Cell Protein for the Transfection of Cos-1 Cells with Polymer-DNA Complexes at a 2/1 and a 4/1
Charge Ratio, n ) 3a
2/1 charge ratio
polymer
PDMAEMA
P(DMAEMA0.96-co-AEMA0.04)
P(DMAEMA0.48-co-AEMA0.42co-HYMIMMA0.10)
P(DMAEMA0.65-co-MA0.35)
polyethyleneimine
4/1 charge ratio
Mw
(kDa)
β gal
(ng/mL)
cell protein
(µg/mL)
% cell
viability
β gal
(ng/mL)
cell protein
(µg/mL)
% cell
viability
201
273
47
5.78 ((0.63)
2.64 ((0.32)
0.01 ((0.03)
43.30 ((1.55)
47.20 ((2.01)
47.40 ((1.89)
108 ((3)
98 ((5)
107 ((1)
19.57 ((0.19)
6.48 ((0.21)
1.66 ((0.90)
40.04 ((2.38)
42.03 ((1.57)
39.52 ((2.62)
103 ((1)
108 ((5)
97 ((2)
316
25
0.02 ((0.02)
22.34 ((1.49)
57.84 ((1.53)
22.24 ((4.89)
106 ((2)
79 ((6)
0.01 ((0.01)
9.25 ((0.83)
48.70 ((3.80)
17.64 ((1.04)
102 ((7)
65 ((9)
a Control: DNA without polymer: β-gal mass 0.08 ng/mL (( 0.05); amount of cell protein 51.77 µg/mL (( 5.42). Lipofectamine: β-gal mass 60.10
ng/mL (( 22.54); amount of cell protein 19.56 µg/mL (( 1.83).
384
Biomacromolecules, Vol. 5, No. 2, 2004
the complexes compared to untreated cells (100% cell
viability). Results were statistically analyzed with the student
t-test.
2.9. Confocal Microscopy Studies. Cellular internalization studies were carried out with a Zeiss model LSM 410
invert on the basis of a Zeiss Axiovert 100 fluorescence
microscope. The apparatus was equipped with an argon laser
(488 nm) and a Helium-Neon laser (543 and 633 nm).
Cos-1 cells were seeded at a density of 105 cells/0.25 cm2
and grown for 48 h in DMEM supplemented with 10% FBS
and 1% Penicillin/Streptamycin (104 IU/mL).
Cells were washed and preincubated in 200 µL DMEM.
The complexes (7.5 µL complex prepared as in section 2.8)
were added to each well. 30 min before measuring 50 nM
Lysotracker Red was added. Prior to microscopy examination, cells were washed and placed in PBS.
3. Results and Discussion
Previously, we described the synthesis and the physicochemical and biological evaluation of a series of cationic
polymethacrylates as nonviral gene delivery systems.27,29-30
These studies showed that PDMAEMA, a polymer containing only tertiary amine functions, reaches 90% of the
transfection efficiency of PEI, one of the golden standards
in the field of polymeric gene delivery systems. Although
DMAEMA-based copolymers containing imidazole groups
(HYMIMMA) or acid functions (MA) possess similar
buffering properties as PEI, these polymers were not able to
transfect Cos-1 cells (monkey kidney fibroblasts). In the
present work, we investigated the cellular internalization and
the subcellular localization of the complexes based on these
polymers.
3.1. Polymer Synthesis and Labeling. Since PDMAEMA
and P(DMAEMAx-co-HYMIMMAy) do not contain primary
amine functions, necessary for further functionalization of
these polymers, we first synthesized a t-Boc protected amine
containing methacrylate (t-Boc AEMA). In a subsequent step,
this monomer was copolymerized with DMAEMA and/or
t-Boc HYMIMMA yielding polymers containing primary
amines, which could be used for the coupling of a fluorophore. t-Boc AEMA was synthesized in a two step procedure
(Figure 1). First, the amine function of ethanolamine was
protected by reaction with di-tert-butyl dicarbonate. This
product was converted into the corresponding methacrylate
by reaction with methacrylic anhydride.
Starting from this monomer, two different types of
polymers were synthesized: a copolymer containing DMAEMA and t-Boc AEMA and a terpolymer containing DMAEMA, t-Boc AEMA, and t-Boc HYMIMMA. The t-Boc
protecting groups of both polymers were removed by
acidolysis in trifluoro acetic acid. The chemical composition
of the polymers as determined by 1H NMR spectroscopy and
their molecular weight, as determined by GPC, are shown
in Table 1. The refractive index increments (dn/dc) of the
polymers needed for the calculation of the molecular weight
are also given in Table 1. The chemical structure of the
different types of polymers is shown in Figure 2.
The synthetic pathway applied in this work is a simple
procedure to obtain organic soluble methacrylate (or acry-
Dubruel et al.
late)-based polymers containing primary amine functions.
Earlier, van Dijk-Wolthuis et al. proposed a method in which
DMAEMA and AEMA were copolymerized in water.36
PEI, P(DMAEMA0.96-co-AEMA0.04) and P(DMAEMA0.48co-AEMA0.42-co-HYMIMMA0.10) were coupled via their
amine groups to a spacer-linked succinimidyl ester of Oregon
Green (see Figure 2).37 P(DMAEMA0.65-co-MA0.35) was
modified with an amine containing fluorophore, 5-(aminomethyl)fluorescein hydrochloride (see Figure 2), using EDC
as coupling agent.
3.2. DNA Condensation Studies. The ability of the
different polymers to condense DNA was studied by agarose
gel electrophoresis. The charge ratio at which DNA condensation occurs for the different polymers is shown in Table
2. As an example, the agarose gel of P(DMAEMA0.96-coAEMA0.04) and P(DMAEMA0.48-co-AEMA0.42-co-HYMIMMA0.10 is shown in Figure 3. The results show that all
polymers are able to condense DNA, being a prerequisite
for any polymer to be used as a DNA vector. All polymers,
except PEI, are condensing DNA at a similar charge ratio
(between 1.2/1 and 1.6/1). Most likely, the presence of
backbone amine functions in PEI enhances the DNA
condensation properties of this polymer, resulting in a lower
charge ratio for DNA condensation (0.4/1).
3.3. Transfection and Toxicity Studies. The polymers
synthesized in this work were evaluated for their biological
activity, including their transfection efficiency (determination
of β-gal mass) and their toxicity (determination of the amount
of cell protein and MTT reduction). The results are shown
in Table 3.
The β-gal expression of cells grown for 48 h after 4 h
exposure to the polymer-DNA complexes was comparable
for PDMAEMA-DNA complexes prepared at a 4/1 charge
ratio and PEI-DNA complexes prepared at a 2/1 charge
ratio. Compared to PDMAEMA, copolymers containing
tertiary amines (DMAEMA) and primary amine (AEMA)
were significantly lower in the transfection efficiency, both
at charge ratios of 2/1 and 4/1 (P < 0.002). This might be
attributed to both differences in chemical composition and
molecular weight. As shown previously, the molecular weight
strongly influences the transfection efficiency of both PEI
and polymethacrylates.30,38-39 Imidazole and carboxylic acid
containing polymers were not able to transfect Cos-1 cells.
The amount of cell protein (as determined by the BCA assay)
of cells treated with polymethacrylate-DNA complexes is
at least twice that of cells treated with PEI-DNA complexes.
This is also reflected by the MTT assay in which cells treated
with PEI-DNA complexes have a significantly (P < 0.02)
lower cell viability compared to cells treated with polymethacrylate-DNA complexes (Table 3). Our results show
that the determination of the total cell protein content is a
simple and time-saving method for the toxicity determination
of polymer-DNA complexes. This is in accordance with
previous reports.30,40-41
3.4. Confocal Microscopy Studies. To find out whether
the differences in transfection efficiency in Cos-1 cells are
related to differences in cellular internalization and subcellular distribution, confocal microscopy experiments were
performed on Cos-1 cells treated with the polymer-DNA
Keys to Successful Gene Delivery
Biomacromolecules, Vol. 5, No. 2, 2004 385
Figure 5. Cellular internalization of P(DMAEMA0.96-co-AEMA0.04)DNA complexes as studied by confocal microscopy. The complexes
were prepared at a 2/1 charge ratio. The bars represent 10 µm.
Figure 4. Cellular internalization of PEI-DNA complexes as studied
by confocal microscopy. The complexes were prepared at a 2/1
charge ratio. Part E represents endosomal/lysosomal staining of
Cos-1 cells. The bars represent 10 µm.
complexes containing fluorescently labeled polymers. Cells
were co-incubated with Lysotracker Red DND-99 probe,
wich specifically stains acidic organelles (i.e., late endosomes
and lysosomes).42 In Figures 4-7, the green fluorescence
corresponds to polymer-DNA complexes, whereas red
fluorescence arises from the Lysotracker Red probe. Colocalization of both signals is reflected by yellow fluorescence. The effect of the incubation time and the charge ratio
of the complexes on the cellular internalization and subcellular localization were evaluated.
3.4.1. Effect of the Incubation Time. Figure 4 shows the
results obtained for PEI-DNA complexes prepared at a 2/1
charge ratio. After 15 and 45 min incubation (Figure 4, parts
A and B), most of the green fluorescently labeled polymer
was colocalized with the LysoTracker Red probe, indicating
endosomal and lysosomal localization of PEI-DNA complexes. It should also be noted that no membrane associated
green fluorescence appears. These results are in very good
agreement with those obtained earlier by Rémy-Kristensen
et al. using synchronized L929 fibroblasts,43 showing that
PEI-DNA complexes were efficiently taken up in the
endosomes in less than 10 min.
At incubation times of 1.5 h or longer (Figure 4, parts C
and D), all yellow fluorescence disappeared, indicating that
co-localization decreased. PEI-DNA complexes are thus
gradually released from the endosomes and lysosomes into
the cytoplasm of the cell. It can be concluded that PEIDNA complexes are taken up rapidly and not continuously
over the entire incubation period. These findings can be
useful for fine-tuning the transfection protocols for PEIDNA complexes since shorter incubation times might
decrease the toxicity of PEI-DNA complexes (or polymerDNA complexes in general).
In the 4 h incubation period of PEI-DNA complexes with
Cos-1 cells, we did not observe a clear uniform nuclear
localization of labeled PEI. These results are in agreement
with those obtained by Rémy-Kirstensen et al. in synchronized L929 fibroblasts43 and Bieber et al. in PaTu 8902
carcinoma cells,44 but they are in contrast with those obtained
by Godbey et al. using EA.hy 926 cells,45-46 suggesting that
PEI transfection may involve different mechanisms, depending on the cell type.
After 15 min, P(DMAEMA0.96-co-AEMA0.04)-DNA complexes (2/1 charge ratio) are taken up by Cos-1 cells (Figure
5A). However, compared to PEI-DNA complexes (Figure
4A), a higher amount of red spots, indicative for endosomes
without polymer-DNA complexes, is observed. After 30 min
incubation, all of the Lysotracker Red probe is colocalized
with P(DMAEMA0.96-co-AEMA0.04)-DNA complexes, indicated by an decrease in the amount of red spots and an
increase in the amount of yellow spots (Figure 5B). After 4
h incubation (Figure 5 C), most P(DMAEMA0.96-coAEMA0.04)-DNA complexes are localized in the cytoplasm,
whereas some complexes remain localized in the acidic cell
organelles. These findings indicate a difference in the kinetics
of cellular internalization and endosomal escape of PEI-
386
Biomacromolecules, Vol. 5, No. 2, 2004
Dubruel et al.
Figure 7. Cellular internalization of P(DMAEMA0.65-co-MA0.35)-DNA
complexes as studied by confocal microscopy. The complexes were
prepared at a 2/1 charge ratio. The bars represent 10 µm.
Figure 6. Cellular internalization of P(DMAEMA0.48-co-AEMA0.42-coHYMIMMA0.1)-DNA complexes as studied by confocal microscopy.
The complexes were prepared at a 2/1 charge ratio (parts A-C) or
a 4/1 charge ratio (parts D and E). The bars represent 10 µm.
DNA complexes and P(DMAEMA0.96-co-AEMA0.04)-DNA
complexes. Compared to P(DMAEMA0.96-co-AEMA0.04)DNA complexes, PEI-DNA complexes are taken up more
rapidly into Cos-1 and are released more rapidly and to a
greater extent into the cytosol.
The cellular internalization of P(DMAEMA0.48-co-AEMA0.42-co-HYMIMMA0.10)-DNA complexes prepared at a
2/1 charge ratio is less efficient than for PEI- and P(DMAEMA0.96-co-AEMA0.04)-based complexes. After incubation for 15 min, no cellular accumulation of polymer-DNA
complexes was observed (Figure 6A). At an incubation time
of 2 h, no co-localization was observed (Figure 6B). After
incubation for 4 h, some co-localization was observed, but
most of the endosomes were only stained with the Lysotracker Red probe (Figure 6C). These results indicate that the low
transfection efficiency of P(DMAEMA0.48-co-AEMA0.42-coHYMIMMA0.10)-DNA complexes at a 2/1 charge in Cos-1
might be attributed to the low cellular internalization of the
complexes.
After 15 min, the cellular internalization of P(DMAEMA0.65co-MA0.35) based complexes prepared at a 2/1 charge ratio
in Cos-1 cells was very low (Figure 7A). After 30 min, these
complexes were localized at the plasma membrane but are
not internalized in the cytosol (Figure 7B). After incubation
for 1 h, co-localization of the complexes with the Lysotracker
Red probe was observed, indicative for endosomal and
lysosomal localization (Figure 7C). After incubation for 4
h, most complexes were still located in the endosomal
compartment (data not shown), as no accumulation of the
polymer in the cytosol occurred. Thus, the low transfection
efficiency of this polymer compared to PEI can be attributed
to a (s)lower uptake via endocytosis and an unefficient
release of the complexes in the cytoplasm.
3.4.2. Effect of the Charge Ratio of the Complexes. Since
P(DMAEMA0.48-co-AEMA0.42-co-HYMIMMA0.10)-DNA
complexes were not able to transfect Cos-1 cells, neither at
a 2/1 nor at a 4/1 charge ratio, we investigated if the low
transfection activity at a 4/1 charge ratio is also related to a
low cellular internalization of these complexes. At a 4/1
charge ratio, the amount of positive charges in the complexes
is much higher compared to those prepared at a 2/1 charge
ratio. It might thus be possible that the cellular internalization
and the subcellular localization depend on the charge ratio
of the complexes used.
After incubation for 1 h, the polymer-DNA complexes
prepared at a 4/1 charge ratio are localized at the cell
membrane and in acidic cell organelles (Figure 6D). After
incubation for 4 h, membrane staining decreased with some
indication of complexes in the endosomes (Figure 6E). These
results show that P(DMAEMA0.48-co-AEMA0.42-co-HYMIMMA0.10)-DNA complexes prepared at a 4/1 charge ratio are
taken up faster than those at a 2/1 charge ratio. At both charge
ratios, complexes are not able to escape from the acidic
organelles in the 4 h incubation of Cos-1 cells, which might
explain the low transfection efficiency.
Keys to Successful Gene Delivery
It can be concluded that polymethacrylate based complexes
with buffering properties similar to PEI are taken up in Cos-1
cells but are not released as efficiently as PEI from the
endosomal compartment. Thus, the buffering properties of
cationic polymethacrylates are not the only key to efficient
escape from the endosomes. It should be considered that
other factors such as the membrane interaction properties
might limit the release of the complexes from the endosomes.
Indeed, we demonstrated earlier that the membrane interactive properties of PEI-DNA complexes are higher compared
to the polymethacrylate-DNA complexes (as shown earlier
by haemolysis studies30). This may influence the release of
the complexes from the endosomal compartment. Moreover
PEI-DNA complexes swell when the pH is lowered from
physiological to endosomal conditions, whereas the size of
polymethacrylate-DNA complexes decreases when the pH
is lowered.27 It can be anticipated that this will affect the
release of the complexes into the cytoplasm of cells.
To further explore both phenomena, we are presently
studying the effect of varying pH on the particle size of PEIand PDMAEMA-DNA complexes in more detail, trying to
mimmick the cellular internalization and endosomal release
of polymer-DNA complexes. In addition, we are optimizing
the membrane interactive properties of the polymethacrylates
in an attempt to try to increase their transfection efficiency.
4. Conclusions
In the present work, we synthesized a series of cationic
polymethacrylates containing fluorophores. Transfection
studies revealed that complexes based on imidazole and acid
function containing polymethacrylates, which possess similar
buffering properties as PEI, are not able to transfect Cos-1
cells. Confocal microscopy pointed out that these complexes
are taken up into cells via endocytosis but are slowly released
from acidic organelles (late endosomes and/or lysososmes).
These findings clearly indicate that the buffering properties
of polymethacrylates are not the only key to successful
endosomal escape and gene delivery.
Acknowledgment. The authors thank the Flemish institute for the promotion of Scientific-Technological Research
in Industry (IWT), the Fund for Scientific Research-Flanders
(FWO), the Belgian Ministry of Scientific Programming,
IUAP/PAI-V, and the European Union’s Biotechnology
Program Contract No. 97 2334 with support from INCO
Contract No. IC 20 CT 970005.
Abbreviations
AEMA: aminoethyl methacrylate
AIBN: 2,2′-azobis(2-methylpropionitrile)
DMAEMA: 2-N,N-(dimethylaminoethyl) methacrylate
MA: methacrylic acid
HYMIMMA: 4-methyl-5-imidazoyl methyl methacrylate
Mw: weight average molecular weight
PEI: polyethyleneimine
t-Boc: tert-butyloxycarbonyl
GPC: gel permeation chromatography
EDC: 1-(3-dimethylaminopropyl)-3-ethylcarbodiimide hydrochloride
DMEM: Dulbecco’s Modified Eagle medium
Biomacromolecules, Vol. 5, No. 2, 2004 387
FBS: fetal bovine serum
PBS: phosphate buffered saline
NMR: nuclear magnetic resonance spectroscopy
MTT: 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyl-tetrazolium
bromide
AIBN: 2, 2′-azobis(2-methylpropiononitrile)
DNA: deoxyribonucleic acid.
References and Notes
(1) Garnett, M. C. Crit. ReV. Ther. Drug Carrier Syst. 1999, 16 (2),
147-207.
(2) Mountain, A. Trends Biotechnol. 2000, 18, 119-128.
(3) Rakoczy, P. E.; Shen, W. Y.; Rolling, F.; Constable, I. J. Drug DeV.
Res. 1999, 46, 277-285.
(4) Clark, W. R. In The New Healers: the Promise and Problems of
Molecular Medicine in the Twenty-First Century; Oxford University
Press: New York, 1997.
(5) http://www-micro.msb.le.ac.uk/335/peel/peel1.html#intro
(6) Verma, I.; Somia, N. Nature 1997, 389 (6648), 239-242.
(7) Worgall, S.; Wolff, G.; FalckPedersen, E.; Crystal, R. Human Gene
Therapy 1997, 8 (1), 37-44.
(8) Felgner, J.; Kumar, R.; Sridhar, C.; Wheeler, C.; Tsai, Y.; Border,
R.; Ramsey, P.; Martin, M.; Felgner, P. J. Biol. Chem. 1994, 269
(4), 2550-2561.
(9) Kabanov, A. V.; Kabanov, V. A. AdV. Drug DeliVery ReV. 1998,
30, 49-60.
(10) Kircheis, R.; Wightman, L.; Wagner, E. AdV. Drug DeliVery ReV.
2001, 53, 341-358.
(11) Cotten, M.; Längle-Roualt, F.; Kirlappos, H.; Wagner, E.; Mechtler,
K.; Zenke, M.; Beug, H.; Birnstiel, M. L. Proc. Natl. Acad. Sci. U.S.A.
1990, 87, 4033-4037.
(12) Howard, K. A.; Dash, P. R.; Read, M. L.; Ward, K.; Tomkins, L.
M.; Nazarova, O.; Ulbrich, K.; Seymour, L. W. Biochem. Biophys.
Acta 2000, 1475, 245-255.
(13) Trubetskoy, V. S.; Budker, V. G.; Hanson, L. J.; Slattum, P. M.;
Wolff, J. A.; Hagstrom, J. E. Nucleic Acids Res. 1998, 26 (18), 41784185.
(14) Abdallah, B.; Hassan, A.; Benoist, C.; Goula, D.; Behr, J. P.;
Demeneix, B. A. Human Gene Therapy 1996, 7, 1947-1954.
(15) Erbacher, P.; Roche, A. C.; Monsigny, M.; Midoux, P. Bioconjugate
Chem. 1996, 6, 401-410.
(16) Ramsay, E.; Gumbleton, M. J. Drug Targeting 2002, 10 (1), 1-9.
(17) Hansma, H. G.; Golan, R.; Hsieh, W.; Lollo, C. P.; Mullen-Ley, P.;
Kwoh, D. Nucleic Acids Res. 1998, 26 (10), 2481-2487.
(18) Mannisto, M.; Vanderkerken, S.; Toncheva, V.; Elomaa, M.;
Ruponen, M.; Schacht, E.; Urtti, A. J. Controlled Release 2002, 169189.
(19) Dekie, L.; Toncheva, V.; Dubruel, P.; Schacht, E. H.; Barrett, L.;
Seymour, L. W. J. Controlled Release 2000, 65 (1-2), 187-202.
(20) Vanderkerken, S.; Vanheede, T.; Toncheva, V.; Schacht, E.; Wolfert,
MA.; Seymour, L.; Urtti, A. J. Bioact. Compat. Polym. 2000, 15
(2), 115-138.
(21) Boussif, O.; Lezoualc’h, F.; Zanta, M. A.; Mergny, M. D.; Scherman,
D.; Demeneix, B.; Behr, J. P. Proc. Natl. Acad. Sci. U.S.A. 1995,
92, 7297-7301.
(22) Abdallah, B.; Hassan, A.; Benoist, C.; Goula, D.; Behr, J. P.;
Demeneix, B. A. Human Gene Therapy 1996, 7, 1947-1954.
(23) Von Harpe, A.; Petersen, H.; Li, Y.; Kissel, T. J. Controlled Release
2000, 69, 309-322.
(24) Zanta, M. A.; Boussif, O.; Adib, A.; Behr, J. P. Bioconjugate Chem.
1997, 8, 839-844.
(25) Bettinger, T. B.; Remy, J. S.; Erbacher, P. Bioconjugate Chem. 1999,
10, 558-561.
(26) van de Wetering, P.; Cherng, J. Y.; Talsma, H.; Crommelin, D. J.
A.; Hennink, W. E. J. Controlled Release 1998, 53 (1-3), 145153.
(27) Dubruel, P.; Toncheva, V.; Schacht, E. H. J. Bioact. Compat. Polym.
2000, 15 (3), 191-213.
(28) Dubruel, P.; Schacht, E. H. J. Bioact. Compat. Polym. 2000, 15 (4),
279-296.
(29) Dubruel, P.; De Strycker, J.; Westbroek, P.; Bracke, K.; Temmerman,
E.; Schacht, E. H. Polym. Int. 2002, 51, 948-957.
(30) Dubruel, P.; Christiaens, B.; Vanloo, B.; Bracke K.; Rosseneu M.;
Vandekerckhove J.; Schacht E. Eur. J. Pharm. Sci. 2003, 18 (3-4),
211-220.
388
Biomacromolecules, Vol. 5, No. 2, 2004
(31) Rungsardthong, U.; Deshpande, M.; Bailey, L.; Vamvakaki, M.;
Armes, S. P.; Garnett, M. C.; Stolnik, S. J. Controlled Release 2001,
73, 359-380.
(32) Hosseinkhani, H.; Tabata, Y J. Controlled Release 2003, 86 (1), 169182.
(33) Hosseinkhani, H.; Aoyama, T.; Yamamoto, S.; Ogawa, O.; Tabata,
Y Pharm. Res. 2002, 19 (10), 1471-1479.
(34) Luten, J.; van Steenis, J.; Schuurmans-Nieuwenbroek, N.; van
Nostrum, C.; Hennink, W. J. Cotrolled Release 2003, 87 (1-3), 277279.
(35) Behr, J. P. Chimia 1997, 51 (1-2), 34-36.
(36) van Dijk-Wolthuis, W.; van de Wetering, P.; Hinrichs, W.; Hofmeyer,
L.; Liskamp, R.; Crommelin, D.; Hennink, W. Bioconjugate Chem.
1999, 10, 687-692.
(37) Molecular Probes Handbook, Handbook Section 1.5 Fluorescein,
Oregon Green and Rhodamine Green Dyes.
(38) Mumper, R. J.; Duguid, J. G.; Khursheed, A.; Barron, M. K.; Nitta,
H.; Rolland, A. P. Pharm. Res. 1996, 13 (5), 701-709.
Dubruel et al.
(39) Godbey, W. T., Wu, K. K., Mikos, A. G. J. Biomed. Mater. Res.
1999, 45, 268-275.
(40) Gebhart, C. L.; Kabanov, A. V. J. Controlled Release 2001, 73, 401416.
(41) Benns, J. M.; Mahato, R. I.; Kim, S. W. J. Controlled Release 2002,
79, 255-269.
(42) Molecular Probes Product Information Sheet, mp07525.
(43) Rémy-Kirstensen, A.; Clamme, J. P.; Vuillemier, C.; Kuhry, J. G.;
Mély, Y. Biochim. Biophys. Acta 2001, 1514, 21-32.
(44) Bieber, T.; Meissner, W.; Kostin, S.; Niemann, A.; Elsasser, H. P.
J. Controlled Release 2002, 82, 441-454.
(45) Godbey, W. T.; Wu, K. K.; Mikos, A. G. Proc. Natl. Acad. Sci.
U.S.A. 1999, 96, 5177-5181.
(46) Godbey, W. T.; Barry, M. A.; Saggau, P.; Wu, K. K.; Mikos, A. G.
J. Biomed. Mater. Res. 2000, 51, 321-328.
BM034438D
Enhancement of polymethacrylate-mediated gene delivery by Penetratin
Christiaens Bart1, Dubruel Peter2, Grooten Johan3, Goethals
Vandekerckhove Joël1,4, Schacht Etienne2,5 and Rosseneu Maryvonne1
Marc1,4,
1
Dept. Biochemistry and 2Dept. Organic Chemistry of the Ghent University; 3Dept.
Molecular Biology and 4Dept. Medical Protein Research of the Flanders
Interuniversity Institute for Biotechnology (VIB); 5Institute for Biomedical Technology
(IBITECH); 9000 Ghent, Belgium
Correspondence to:
Bart Christiaens,
Dept. Biochemistry, Ghent University,
Hospitaalstraat 13, 9000 Gent, Belgium.
Tel: + 32 9 264 92 73
Fax: + 32 9 264 94 96
e-mail: [email protected]
Abstract
Polymethacrylates are vinyl-based polymers that are used for DNA transfection.
Cationic polymethacrylates efficiently condense DNA by forming inter-polyelectrolyte
complexes. Their use for DNA transfection is however limited due to their low ability
to interact with membranes. In order to increase transfection efficiency, we combined
polymethacrylates with Penetratin, a 16-residue water-soluble peptide that
internalises into cells through membrane translocation. DNA condensation was
assessed using physicochemical methods, while transfection efficiency and cellular
internalisation were studied using Cos-1 cells. Agarose gel electrophoresis
retardation, ethidium bromide exclusion tests and dynamic light scattering
measurements showed that the stability of the polymethacrylate-DNA complexes is
not affected by addition of Penetratin. Transfection efficiency of polymethacrylateDNA complexes into Cos-1 cells increased by addition of Penetratin and became
comparable to that of PEI-DNA complexes. Confocal microscopy and flow cytometry
indicated that Penetratin mainly enhances endolysosomal escape of
polymethacrylate-DNA complexes, and increases their cellular uptake. Since the
cellular toxicity of polymethacrylate-DNA-Penetratin complexes remains low,
especially compared to PEI, this transfection system opens new perspectives for
gene therapy.
Keywords
gene therapy, Penetratin, transfection, membrane destabilisation, polymethacrylate,
polymer-DNA complex
Bijlage Doctoraatsthesis Bart Christiaens
Universiteit Gent 2004
1
1. Introduction
Gene therapy consists in the delivery of polynucleotides into cells, in order to alter the
expression of a given protein, thus resulting into a therapeutic benefit. The success
of this strategy depends upon the efficiency of cellular delivery and expression of the
gene. Spontaneous cellular uptake of polynucleotides is hampered by their negative
charge, large hydrodynamic volume and degradation by nucleases (Bally et al., 1999;
Garnett, 1999). In order to overcome these problems, polynucleotides have to be
combined with a transfection vector.
Although viruses are at present the most efficient vectors, their use is restricted due
to limitations in the DNA size, immunogenicity and putative long-term risks (SchmidtWolf, Schmidt-Wolf, 2003). Consequently, non-viral synthetic vectors have been
developed, including cationic liposomes (Behr, 1994) and polymeric gene delivery
vectors (De Smedt et al., 2000; Garnet, 1999), with polyethylenimine (PEI) as one of
the most successful polymers (Boussif et al., 1995). DNA is condensed and
protected against degradation by formation of inter-polyelectrolyte complexes (IPEC)
with partially protonated PEI (Godbey et al., 2000). The relatively high transfection
efficiency of these complexes is explained by the ‘proton sponge’ theory (Behr, 1997).
The positively charged complexes are taken up by cells via endocytosis (Godbey et
al., 1999a, 2001a; Rémy-Kristensen et al., 2001) and are further protonated at low
endosomal pH. The resulting influx of protons and chloride counter-ions creates an
osmotic effect and subsequent endosomal swelling. Ultimately, PEI-DNA complexes
are released in the cytosol. Besides polymer interactions with the plasma membrane,
endosomal escape thus represents a critical step in cellular transfection (Pouton,
Seymour, 2001).
As the efficiency of PEI transfection is limited by its significant cellular toxicity
(Dubruel et al., 2003; Godbey et al, 2001b), we synthesised of a series of non-toxic
polymethacrylates containing functional side groups with varying pKa, that efficiently
condense DNA (Dubruel et al., 2000, 2002). In spite of their buffering capacity in the
endosomal pH-range (pH 5.5 - 7.4), the transfection efficiency of these polymers
remained lower than that of PEI (Dubruel et al., 2003). Confocal microscopy
experiments further showed that cellular internalisation and endosomal release of
polymethacrylate-DNA complexes remains slow compared to PEI (Dubruel et al.,
2004). As polymethacrylates are less haemolytic and cytotoxic than PEI, these data
suggest that, besides endosomal buffering, membrane interactions probably
modulate the efficiency of polymethacrylate-mediated transfections.
In an attempt to increase the transfection efficiency on Cos-1 cells, we combined
polymethacrylates with Penetratin, a 16-residue peptide derived from the third helix of
the DNA-binding domain of the Drosophila Antennapedia homeoprotein (Derossi et
al., 1994), which belongs to the family of cell-penetrating peptides (CPP). These
water-soluble peptides with a low lytic activity have been used as vectors for cellular
internalisation of hydrophilic biomolecules (Derossi et al., 1998; Lindgren et al., 2000;
Stephens, Pepperkok, 2001). The mechanism for cellular internalisation of the CPP
peptides has not been unravelled yet, although membrane interaction and
translocation are probably critical factors (Prochiantz, 1996; Drin et al., 2001, 2003;
Christiaens et al., 2002, 2004). Penetratin has been widely used for (phospho)peptides and PNA internalisation, but DNA internalisation is restricted to 55-mer
oligonucleotides (Braun et al., 2002; Dunican, Doherty, 2001;Pooga et al., 1998;
Prochiantz, 1998). As Penetratin binding to DNA suppresses its membrane
translocation properties, internalisation of expression vectors requires preventive
Bijlage Doctoraatsthesis Bart Christiaens
Universiteit Gent 2004
2
blocking of peptide-DNA interaction prior to transfection, for example by combination
with a cationic, DNA-binding polymer.
In this paper, we carried out a systematic physicochemical study of the influence of
Penetratin upon DNA condensation by polymethacrylates and measured the cellular
uptake and transfection efficiency of polymethacrylate-DNA complexes combined with
Penetratin on Cos-1 cells, in order to design new vectors with increased transfection
efficiency.
Bijlage Doctoraatsthesis Bart Christiaens
Universiteit Gent 2004
3
2. Materials and Methods
2.1. Materials
Branched PEI (Mw = 25 kDa) and 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyl-tetrazolium
bromide (MTT) were from Aldrich. 4-Chloro-7-nitro-1,2,3-benzoxadiazole (NBD-Cl),
ethidium bromide (EtBr), linear calf thymus DNA (15 - 23 kb), boric acid, agarose
(electrophoresis grade), N-(2-hydroxyethyl)piperazine-N’-2-ethane-sulfonic acid
(HEPES) and bromophenol blue were from Sigma. Ethylenediamine tetra-acetic acid
(EDTA) was from Fluka. Glycerol was from Vel. LysoTracker Red DND-99 and
Oregon Green 488-X succinimidyl ester were from Molecular Probes. pCMVbeta
plasmid (7.2 kb) was from Clontech. Foetal bovine serum (FBS) was from Perbio.
Dulbecco’s Modified Eagle medium (DMEM), Penicillin, Streptomycin and
LipofectamineTM were from Gibco. All products were used as received following the
instructions from the suppliers. The water used throughout this study was double
distilled.
2.2. Polymethacrylate synthesis and characterisation
Copolymers were obtained by radical polymerisation of the appropriate monomers, as
described previously (Dubruel et al., 2000), their molecular weight was determined by
gel permeation chromatography (GPC). The polymer polydispersity (d) is defined as
the ratio of the weight average molecular weight (Mw) over the number average
molecular weight (Mn).
For fluorescent labelling of primary amino groups, 20 mg polymer was dissolved in a
carbonate buffer (pH 8.3). Oregon Green 488-X succinimidyl ester, dissolved in
dimethylformamide, was added drop wise at a molar ratio of 2 mol dye per 100 mol
polymethacrylate side groups, and incubated under continuous stirring for 1 h in the
dark at room temperature. Excess of Oregon Green 488-X succinimidyl ester was
removed by dialysis, first against 1 M NaCl for 48 h and then against water for 48 h,
at room temperature. As determined by UV absorbance at 496 nm, molar
percentages of the P(DMAEMA0.87-co-AEMA0.13) and P(DMAEMA0.48-co-AEMA0.42-coHYMIMMA0.10) primary amine AEMA side groups labelled with Oregon Green probe
were 1.4 and 1.5 respectively.
2.3. Peptide synthesis
Penetratin synthesis was carried out by Fmoc-tBu synthesis on a 431A peptide
synthesizer (Applied Biosystems Inc., USA), as described previously (Christiaens et
al., 2004). The unlabelled and NBD-labelled peptides were purified by reverse-phase
HPLC, using an acetonitrile gradient, in an aqueous solution of 0.1 % trifluoroacetic
acid. Purified peptides eluted as a single peak and the expected molecular weights
were checked by MALDI-TOF-MS (Gevaert et al., 1998). Peptides were lyophilised
and stored at 4 °C. Concentration of the freshly prepared peptide solutions were
determined by absorbance measurements at respectively 280 nm, using a molar
absorption coefficient of 5600 M-1 cm-1 per Trp residue for unlabelled peptides, and at
460nm, using a molar absorption coefficient of 22000 M-1 cm-1 for NBD-labelled
peptides.
Bijlage Doctoraatsthesis Bart Christiaens
Universiteit Gent 2004
4
2.4. Polymer-DNA complex formation according to the polymer-DNA charge ratio
The stoechiometry of the polymer-DNA complex formation in water was defined as
the polymer-DNA charge ratio (ϕ), which is the number of polymer cationic charges to
DNA anionic charges (Felgner et al., 1997). A DNA mass per charge of 325 Da was
used. The mass per charge of the copolymers was calculated assuming only
protonation of the primary and tertiary amines of the AEMA and DMAEMA side
groups respectively and considering the imidazole groups (HYMIMMA) as neutral.
Polymer and DNA were mixed to form complexes, prior to Penetratin addition. In all
experiments, Penetratin concentrations in the aqueous polymer-DNA complex
mixture are expressed in µmol/l.
2.5. Agarose gel electrophoresis retardation
The complexes, formed by polymer addition to an aqueous DNA solution (20 mg/l)
were incubated with 0 - 100 µM Penetratin (15 min at 22 °C). 20 µl of the
polymethacrylate-DNA-Penetratin mixtures were run on a 1 % (w/w) agarose gel.
Gels were stained in an aqueous ethidium bromide solution (0.5 mg/l) for 1 h at room
temperature.
2.6 Ethidium bromide exclusion
Titration of polymethacrylate-DNA complexes with Penetratin was carried out in an
aqueous ethidium bromide solution (0.4 mg/ml), on an Aminco Bowman series 2
spectrofluorimeter, equipped with a cuvette holder thermostated at 22 °C. Ethidium
bromide fluorescence emission intensity of the polymer-DNA-Penetratin complexes
were measured at 605 nm, with an excitation wavelength at 510 (±4) nm. The
fluorescence intensities were expressed relative to that of free DNA, and were plotted
as a function of the Penetratin concentrations.
2.7. Dynamic light scattering
The size of the polymethacrylate-DNA complexes, after 15 min incubation with
Penetratin, was determined by dynamic light scattering (DLS) on a Malvern 4800
photon correlation spectrometer (PCS) equipped with an air-cooled Ar laser (488 nm).
Hydrodynamic diameters (dH, nm) were calculated from the diffusion coefficient (D)
using the Stokes-Einstein equation: dH = (k B T) / (3 π ηD), with kB, the Boltzmann
constant; T, the absolute temperature (K) and η, the viscosity (mPa s) of the solvent.
2.8. Transfection of Cos-1 cells
The transfection efficiency of the polymethacrylates was studied on Cos-1 cells, using
the pCMVβ plasmid, which encodes for β-galactosidase controlled by the CMV
promotor. The plasmid was expanded in DH10B E. Coli, as described previously
(Dubruel et al., 2003). As a control, Cos-1 cells were also transfected with PEI and
Bijlage Doctoraatsthesis Bart Christiaens
Universiteit Gent 2004
5
with Lipofectamine™. Mock transfected cells were treated with free DNA, in the
absence of transfection vector.
Polymer-DNA-Penetratin complexes were formed by addition either of PEI or
polymethacrylates to an aqueous DNA solution at a concentration of 60 mg/l at a 2/1
or a 4/1 polymer-DNA charge ratio, followed by vortex mixing, at room temperature.
Penetratin was subsequently added at concentrations ranging from 0 - 100 µM in a
final volume of 80 µl, followed by vortex mixing. As a control, DNA was mixed with 37
µg Lipofectamine™.
The transfection protocol was based on the protocol for Lipofectamine™ . The
monkey kidney fibroblast Cos-1 cell line was grown in Dulbecco’s Modified Eagle
medium (DMEM) supplemented with 10 % foetal bovine serum (FBS) and 1 %
Penicillin/Streptomycin (104 IU/ml), further referred to as complete medium. Cos-1
cells were seeded at a density of 2 x 104 cells/cm2 in 12-well plates, and were grown
for 24 hours in complete medium prior to transfection. Cells were then washed twice
with DMEM, pre-incubated in 400 µl DMEM at 37 °C for 2 h (5 % CO2), and 13 µl of
the transfection mixture was added (780 ng DNA/well). Cells were incubated for 4 h
at 37 °C (5 % CO2), washed twice with DMEM and incubated for 48 h in one ml
complete medium (37 °C, 5 % CO2). Finally, the cells were washed three times with
cooled PBS (4 °C), lysed with one ml lysis buffer and harvested. The quantification of
the β-galactosidase mass was performed using the β-gal ELISA kit (Roche). Cellular
protein determinations were performed with the BCA Protein Assay kit (Pierce).
2.9. Cell viability
The cytotoxicity of the polymer-DNA complexes on Cos-1 cells was determined by the
MTT assay, in 24-well plates, under conditions similar to transfections (see 2.8.).
Cells were incubated with the complexes for 3 h, MTT was then added at a
concentration of 1 g/l, and further incubated for one hour at 37 °C. Finally, cells were
lysed with 50% dimethylformamide and 20 % SDS, and the absorbance determined
at 555 nm on a Jasco V-550 spectrophotometer. Results were expressed as the
percentage decrease in MTT reduction of treated compared to untreated cells (100 %
cell viability). All data are reported as mean ± standard deviation for triplicate
samples.
2.10. Confocal microscopy
Fluorescent polymer-DNA-Penetratin complexes were prepared as described above,
using either Oregon Green 488-X-labelled polymer or NBD-labelled Penetratin. Cos1 cells were seeded at 4 x 105 cells / cm2 in Lab-Tek German borosilicate coverglass
with eight chambers (Nalge Nunc International) and grown for 48 h in DMEM
supplemented with 10 % FBS and 1 % Penicillin/Streptamycin (104 IU/ml). Prior to
incubation with the polymer-DNA complexes and with Penetratin, cells were washed
and pre-incubated in 200 µl DMEM for 30 min at 37 °C. 30 min prior to measurement,
cells were incubated at 37 °C with 7.5 µl of the complexes and with 50 nM
LysoTracker Red DND-99. Cells were washed three times with PBS prior to
microscopy. Pictures were taken with a Zeiss LSM410 invert mounted on the basis of
a Zeiss Axiovert 100 microscope.
Bijlage Doctoraatsthesis Bart Christiaens
Universiteit Gent 2004
6
2.11. Flow cytometry
Cos-1 cells were seeded in 12-well plates, as for the transfections. After either 1 or 4
h incubation at 37 °C with DNA-polymer complexes, prepared with Oregon Green
488-X-labelled polymethacrylates, in the presence and absence of Penetratin, cells
were washed with PBS. Cells were detached from the plates with 300 µl Cell
Dissociation Buffer (Life Technologies) and mixed with 300 µl PBS containing 1 %
FBS and 3 µM propidium iodide. Oregon Green 488-X was excited at 488 nm and
fluorescence was measured at 525 nm on a FACScalibur (Becton Dickinson). The
mean fluorescence intensity per cell was recorded as a measure the amount of cellassociated and cell-internalised polymer.
Bijlage Doctoraatsthesis Bart Christiaens
Universiteit Gent 2004
7
3. Results
3.1. Polymethacrylate and Penetratin synthesis
The structures of the polymethacrylates, containing either primary (AEMA) and
tertiary amine groups (DMAEMA), or a combination of those groups with imidazole
side groups (HYMIMMA), are shown in Fig. 1A-B. The chemical composition,
molecular weight, polydispersity and mass per charge of the polymers and of
polyethylenimine (PEI) are summarized in Table 1. The sequence of the Penetratin
peptide is given in Fig. 1C.
3.2. Effect of Penetratin addition on the polymethacrylates-DNA interaction
The Penetratin interaction with free DNA was first investigated. Agarose gel
electrophoresis showed complete retardation of DNA (20 mg/l) migration upon
incubation of the cationic Penetratin peptide (pI = 12.3) at concentrations above 25
µM (Fig. 2), thus demonstrating charge neutralisation of DNA by Penetratin. DNA
titration with 10 - 100 µM Penetratin resulted in a 60 % decrease of the ethidium
bromide (EtBr) fluorescence intensity, compared to free DNA (Fig. 2), indicative of
DNA condensation.
Agarose gel electrophoresis showed complete charge neutralisation of the DNA
negative charges upon incubation with P(DMAEMA0.87-co-AEMA0.13) and
P(DMAEMA0.48-co-AEMA0.42-co-HYMIMMA0.10) polymethacrylates at polymer-DNA
charge ratios of respectively 1.2 and 1.4, compared to 0.4 for PEI. Penetratin
addition had no detectable effect on the DNA charge neutralisation by the polymers
(data not shown).
DNA condensation by P(DMAEMA0.87-co-AEMA0.13) and
P(DMAEMA0.48-co-AEMA0.42-co-HYMIMMA0.10) polymethacrylates at a 2/1 and a 4/1
polymer-DNA charge ratio was more efficient compared to Penetratin. The EtBr
fluorescence decreased to 90 - 80 % of that of free DNA (Fig. 2).
Addition of up to 100 µM Penetratin to these complexes slightly increased DNA
condensation. It did not affect the size of the complexes, which was in the range of
100 - 120 nm, as measured by dynamic light scattering (data not shown).
3.3. Effect of the polymer-DNA charge ratio on the transfection of Cos-1 cells
Transfection of Cos-1 cells by P(DMAEMA0.87-co-AEMA0.13) and P(DMAEMA0.48-coAEMA0.42-co-HYMIMMA0.10) polymethacrylates was compared to the effect of PEI (Mw
= 25 kDa) and Lipofectamine™, at polymer-DNA charge ratios ranging from 2/1 to
10/1 (Table 2). Optimal β-galactosidase (β-gal) expression was reached at a 4/1
polymer-DNA charge ratio for the polymethacrylates, compared to a 2/1 polymer-DNA
charge ratio for PEI. DNA complexes with the P(DMAEMA0.87-co-AEMA0.13) polymer
at a 4/1 polymer-DNA charge ratio, induced a β-gal expression level comparable to
the PEI-DNA complexes at a 2/1 polymer-DNA charge ratio, whereas the
P(DMAEMA0.48-co-AEMA0.42-co-HYMIMMA0.10) polymer had a 10-fold lower
transfection efficiency.
The protein mass of cells grown for 48 h, after 4 h exposure to polymethacrylate-DNA
complexes exceeded by at least a factor 2 that of cells exposed to PEI- and
LipofectamineTM-DNA complexes (Table 2). Increasing the polymer-DNA charge
ratios of PEI-DNA complexes decreased cellular protein mass. Although less
Bijlage Doctoraatsthesis Bart Christiaens
Universiteit Gent 2004
8
pronounced, the same trend was observed for P(DMAEMA0.87-co-AEMA0.13), whereas
P(DMAEMA0.48-co-AEMA0.42-co-HYMIMMA0.10) had no influence on the cellular protein
mass.
Viability of untreated Cos-1 cells was compared to that of cells incubated for 4 h with
polymer-DNA complexes, using the MTT reduction assay. Decreased cell viability
after 4 h incubation with the complexes, was consistent with the decreased amount of
cellular protein measured after 48 h of cellular growth (Table2). Cell viability after
treatment with PEI-DNA complexes, prepared at a 2/1 polymer-DNA charge ratio was
79 %, compared to 60 % for LipofectamineTM-DNA complexes. Cell viability is thus
significantly lower (P<0.05) than for incubation with P(DMAEMA0.87-co-AEMA0.13)- and
P(DMAEMA0.48-co-AEMA0.42-co-HYMIMMA0.10)-DNA complexes prepared at a 4/1
polymer-DNA charge ratio (respectively 94 and 97 %).
3.4. Effect of Penetratin on polymethacrylate-mediated transfection of Cos-1 cells
Penetratin alone was unable to induce DNA transfection of Cos-1 cells at
concentrations ranging between 1 - 100 µM (data not shown). However, Penetratin
addition to polymethacrylate-DNA increased β-gal expression in Cos-1 cells. For
P(DMAEMA0.87-co-AEMA0.13)-DNA complexes prepared at a 2/1 polymer-DNA charge
ratio, an optimal β-gal expression was reached upon addition of 25 µM Penetratin
(Fig. 3A). At a 4/1 polymer-DNA charge ratio, 25 - 100 µM Penetratin significantly
increased the expressed β-gal mass, compared to complexes without Penetratin
(P<0.05, Fig. 3A) and yielded transfection efficiencies comparable to that of
LipofectamineTM-DNA complexes (60 ng/ml β-gal, Table 2). For the P(DMAEMA0.48co-AEMA0.42-co-HYMIMMA0.10)-DNA complexes at a 2/1 polymer-DNA charge ratio,
Penetratin addition had no beneficial effect, whereas at a 4/1 polymer-DNA charge
ratio, β-gal expression significantly increased upon addition of 10 - 25 µM Penetratin
(P<0.05) (Fig. 3B). Penetratin addition to polymethacrylate-DNA complexes did not
influence cellular toxicity, as reflected by the cellular protein determination and the
MTT assay (data not shown).
3.5. Effect of Penetratin on the cellular internalisation of polymethacrylate-DNA
complexes in Cos-1 cells
3.5.1. Effect of Penetratin on the internalisation of P(DMAEMA0.87-co-AEMA0.13)-DNA
complexes
The subcellular localisation of Oregon Green 488-X -labelled P(DMAEMA0.87-coAEMA0.13)-DNA complexes, prepared at a 2/1 and 4/1 polymer-DNA charge ratio, in
Cos-1 cells was determined in the absence and presence of Penetratin.
After 1 h incubation, the P(DMAEMA0.87-co-AEMA0.13)-DNA complexes prepared at a
2/1 polymer-DNA charge ratio, co-localised with the endolysosomal LysoTracker
Red DND-99 marker, as reflected by the yellow signal (Fig. 4A, upper panel). Colocalisation decreased after 4 h, indicative of endolysosomal escape of the
complexes. Addition of 10 µM Penetratin to these complexes decreased colocalisation with the LysoTracker Red DND-99 probe after 1 h, indicative of
enhanced endolysosomal escape of the complexes (Fig. 4A, lower panel).
Bijlage Doctoraatsthesis Bart Christiaens
Universiteit Gent 2004
9
At a 4/1 polymer-DNA charge ratio, P(DMAEMA0.87-co-AEMA0.13)-DNA complexes colocalised with the LysoTracker Red DND-99 probe after 1 - 4 h, although most of
these complexes formed aggregates at the plasma membrane (Fig. 4B, upper panel).
Membrane association decreased while intracellular localisation increased upon
addition of 100 µM Penetratin (Fig. 4B, lower panel). Most of the internalised
complexes were not associated with acidic organelles. Similar results were obtained
upon addition of 25 µM Penetratin.
Flow cytometry experiments showed that Penetratin addition did not increase the
amount of cell-associated and cell-internalised P(DMAEMA0.87-co-AEMA0.13)-DNA
complexes, either at a 2/1 or a 4/1 polymer-DNA charge ratio (data not shown).
3.5.2. Effect of Penetratin on the internalisation of P(DMAEMA0.48-co-AEMA0.42-coHYMIMMA0.10)-DNA complexes
Fig. 5 shows the subcellular distribution of Oregon Green 488-X -labelled
P(DMAEMA0.48-co-AEMA0.42-co-HYMIMMA0.10)-DNA complexes, prepared at a 4/1
polymer-DNA charge ratio, in Cos-1 cells (green signal). After 30 min incubation in
the absence of Penetratin (Fig. 5, upper panel), no internalisation was observed.
After 1 h, the complexes were mainly localised at the plasma membrane, and to a
minor extent in acidic organelles. Localisation in acidic organelles was also observed
after 4 h, while membrane localisation decreased. Addition of 25 µM Penetratin
enhanced the intracellular localisation of P(DMAEMA0.48-co-AEMA0.42-coHYMIMMA0.10)-DNA complexes after 1 - 4 h (Fig. 5, lower panel), although most of
the complexes were not associated with acidic organelles.
Flow cytometry showed that Penetratin addition resulted in a two-fold increase in
P(DMAEMA0.48-co-AEMA0.42-co-HYMIMMA0.10)-DNA complex uptake in Cos-1 cells,
compared to cells incubated with the same complexes in the absence of the peptide
(data not shown).
3.5.3. Cellular localisation of NBD-labelled Penetratin added to the polymethacrylateDNA complexes
Fig. 6 shows the subcellular distribution of 10 µM NBD-labelled Penetratin (green)
added to unlabelled P(DMAEMA0.87-co-AEMA0.13)-DNA complexes prepared in a 2/1
polymer-DNA charge ratio. After 30 min, Penetratin was mainly localised at the cell
membrane. After 1 h, the peptide appeared intracellularly and was found mainly in
acidic organelles after 4 h incubation. Similar results were obtained for 25 µM
Penetratin addition to unlabelled P(DMAEMA0.87-co-AEMA0.13)-DNA and
P(DMAEMA0.48-co-AEMA0.42-co-HYMIMMA0.10)-DNA complexes prepared at a 4/1
polymer-DNA charge ratio (data not shown).
Bijlage Doctoraatsthesis Bart Christiaens
Universiteit Gent 2004
10
4. Discussion
In this study, we compared the efficiency of methacrylate-based copolymers,
containing positively charged primary (AEMA) and tertiary amine (DMAEMA) groups
and uncharged imidazole (HYMIMMA) groups, for DNA transfection, in the absence
and presence of Penetratin. We showed that a combination of DNA condensation by
these polymers, together with membrane translocation by Penetratin, improves the
transfection efficiency to levels comparable to polyethylenimine (PEI) and
LipofectamineTM. In contrast to the latter two vectors, polymethacrylate-DNAPenetratin complexes have low cellular toxicity.
Transfection vectors are aimed at compensating the properties that hamper
spontaneous DNA uptake by cells, i.e. its high negative charge, large hydrodynamic
volume and susceptibility towards nuclease degradation (Bally et al., 1999; Garnett,
1999).
P(DMAEMA0.87-co-AEMA0.13) and P(DMAEMA0.48-co-AEMA0.42-coHYMIMMA0.10) polymethacrylates neutralize DNA negative charges at polymer-DNA
charge ratios above 1.2. Formation of polymethacrylate-based inter-polyelectrolyte
complexes (IPEC) induces DNA charge neutralisation, condensation and size
reduction (Dubruel et al., 2000, 2002) and protects DNA against nuclease
degradation (Dubruel P., unpublished observations).
Transfection of Cos-1 cells by polymethacrylate-DNA complexes is highly dependent
upon the polymer-DNA charge ratio of the complexes, as reported previously (De
Smedt et al., 2000). Polymethacrylates are most efficient at a 4/1 polymer-DNA
charge ratio, compared to a 2/1 polymer-DNA charge ratio for polyethylenimine (PEI).
The transfection efficicency of the fully protonated P(DMAEMA0.87-co-AEMA0.13)
polymer is comparable to that of PEI, whereas that of the P(DMAEMA0.48-coAEMA0.42-co-HYMIMMA0.10) copolymer, containing both protonated and unprotonated
side groups is limited. This is in agreement with previous results showing that the
transfection efficiency depends upon the chemical composition (Dubruel et al., 2003,
2004), and further upon the molecular weight of the polymer (Godbey et al., 1999b).
Since HYMIMMA-containing polymethacrylates have buffering properties comparable
to PEI (Dubruel et al., 2000), the proton sponge theory does not fully account for
polymethacrylate-mediated transfections. In contrast to PEI, polymethacrylates are
neither haemolytic, nor cytotoxic, indicating they do not destabilise cell membranes
(Dubruel et al., 2003). As a result, cellular uptake and endolysosomal escape of
polymethacrylates is slow compared to PEI (Dubruel et al., 2004).
Upon addition of the membrane translocating Penetratin peptide, Cos-1 transfection
efficiency by polymethacrylate-DNA complexes became comparable to PEI and
LipofectamineTM. The highly basic (pI = 12.3) Penetratin peptide neutralizes the DNA
negative charges and induces DNA condensation, as previously reported (Dom et al.,
2003). It can also increase DNA condensation in the polymethacrylate-based
complexes, as shown by ethidium bromide exclusion. Although Dom et al. reported
Penetratin-induced oligonucleotide uptake by Cos-7 cells (Dom et al., 2003), we could
not transfect Cos-1 cells with Penetratin-DNA complexes in the absence of
polymethacrylates. Since we used a 7.2 kb plasmid, the discrepancy might be
explained by the size difference of the internalised DNA. Moreover, agarose gel
retardation electrophoresis and ethidium bromide exclusion showed that although
Penetratin can induce DNA condensation, it is less efficient than the transfection
polymers.
We expected that the membrane translocating Penetratin peptide would increase the
amount of cell-internalised polymer-DNA complexes. Flow cytometry however
showed that this only occurred for the P(DMAEMA0.48-co-AEMA0.42-co-HYMIMMA0.10)
Bijlage Doctoraatsthesis Bart Christiaens
Universiteit Gent 2004
11
and not for the P(DMAEMA0.87-co-AEMA0.13) polymer.
Penetratin addition
nevertheless decreased endolysosomal accumulation of both polymethacrylate-DNA
complexes. Enhanced endolysosomal escape of the complexes, and to a minor
extent increased cellular uptake, thus account for increased transfection efficiency of
polymethacrylates by Penetratin. Transfection efficiency then becomes similar to that
of PEI and LipofectamineTM.
Cell viability measured after 4h incubation of Cos-1 cells with polymer-DNA
complexes was correlated with the amount of cell protein measured after 48h cellular
growth, as shown previously (Benns et al., 2001; Dubruel et al., 2003, 2004; Gebhart
et al., 2001). Upon addition of Penetratin, the P(DMAEMA0.87-co-AEMA0.13)- and
P(DMAEMA0.48-co-AEMA0.42-co-HYMIMMA0.10)-DNA complexes remained non-toxic to
cells, whereas PEI and LipofectamineTM showed significant cellular toxicity, as
previously reported by Godbey et al. for high molecular weight PEI (Godbey et al.,
2001b).
Conclusion
The present study shows that the non-toxic, membrane-translocating Penetratin
peptide increases cellular uptake and endolysosomal escape of polymethacrylateDNA complexes, without affecting the DNA condensation properties of these
polymers. As a consequence, transfection levels comparable to PEI and
LipofectamineTM can be achieved. These data clearly demonstrate that, besides
DNA-condensation and endosomal buffering, membrane interactions are critical for
polymethacrylate-mediated transfections. In view of the low cellular toxicity, a
combination of polymethacrylates and Penetratin constitutes a new promising tool for
gene therapy.
Gratton et al. recently used the Penetratin peptide to enhance viral gene delivery
(Gratton et al., 2003), while covalently coupled Tat CPP enhances lipofection
(Torchilin et al., 2003) and phage-mediated gene delivery (Nakanishi et al., 2003).
This demonstrates that CPP are useful tools to enhance the efficiency of both viral
and synthetic transfection vectors.
Acknowledgements
The authors wish to thank Jan Tavernier for the use of the flow cytometer; Vera
Goosens for technical assistance during the confocal microscopy experiments; and
Berlinda Vanloo, Alain Prochiantz and Alain Joliot for fruitful discussions. Bart
Christiaens was supported by a grant from the ‘Institute for the Promotion of
Innovation through Science and Technology in Flanders’ (IWT-Vlaanderen). Etienne
Schacht and Peter Dubruel acknowledge the financial support of the Belgian
Government, Belgian Resaerch Policy IUAP-programme V/03.
Bijlage Doctoraatsthesis Bart Christiaens
Universiteit Gent 2004
12
References
Bally, M.B., Harvie, P., Wong, F.M., Kong, S., Wasan, E.K., Reimer, D.L., 1999. Biological barriers to cellular delivery
of lipid-based DNA carriers. Adv.Drug Deliv.Rev. 38,291-315.
Behr, J.-P., 1994. Gene transfer with synthetic cationic amphiphiles: prospects for gene therapy. Bioconjug.Chem.
5,382-389.
Behr, J.P., 1997. The proton sponge: a trick to enter cells the viruses did not exploit. Chimica. 51,34-36.
Benns, J.M., Mahato, R.I., Kim, S.W., 2001. Optimization of factors influencing the transfection efficiency of folatePEG-folate-graft-polyethylenimine. J.Control.Release. 79,255-269.
Boussif, O., Lezoualc'h, F., Zanta, M.A., Mergny, M.D., Scherman, D., Demeneix, B., Behr, J.P., 1995. A versatile
vector for gene and oligonucleotide transfer into cells in culture and in vivo: polyethylenimine.
Proc.Natl.Acad.Sci.U.S.A. 92,7297-7310.
Braun, K., Peschke, P., Pipkorn, R., Lampel, S., Wachsmuth, M., Waldeck, W., Friedrich, E., Debus, J., 2002. A
biological transporter for the delivery of peptide nucleic acids (PNAs) to the nuclear compartment of living cells.
J.Mol.Biol. 318,237-243.
Christiaens, B., Symoens, S., Vanderheyden, S., Engelborghs, Y., Joliot, A., Prochiantz, A., Vandekerckhove, J.,
Rosseneu, M., Vanloo, B., 2002. Tryptophan fluorescence study of the interaction of penetratin peptides with model
membranes. Eur.J.Biochem. 269,2918-2926.
Christiaens, B., Grooten, J., Reusens, M., Joliot, A., Goethals, M., Vandekerckhove, J., Prochiantz, A., Rosseneu, M.,
2004. Membrane interaction and cellular internalization of penetratin peptides. Eur.J.Biochem. 271,1187-1197.
Derossi, D., Joliot, A., Chassaing, G., Prochiantz, A., 1994. The third helix of the Antennapedia homeodomain
translocates through biological membranes. J.Biol.Chem. 269,10444-10450.
Derossi, D., Chassaing, G., Prochiantz, A., 1998 Trojan peptides: the Penetratin system for intracellular delivery.
Trends.Cell Biol. 8,84-87.
De Smedt, S.C.; Demeester, J.; Hennink, W.E., 2000. Cationic polymer based gene delivery systems. Pharm.Res.
17,113-26.
Dom, G., Shaw-Jackson, C., Matis, C., Bouffioux, O., Picard, J., Prochiantz, A., Mingeot-Leclercq, M.-P., Brasseur, R.
& Rezsohazy, R., 2003. Cellular uptake of Antennapedia Penetratin peptides is a two-step process in which phase
transfer precedes a tryptophan-dependent translocation. Nucleic.Acids.Res. 31,556-561.
Dubruel,P.; Toncheva,V.; Schacht,E.H., 2000. pH sensitive vinyl copolymeren as vectors for gene therapy. Journal of
Bioactive and Compatible Polymers. 15,191-213.
Dubruel, P., De Strycker, J., Westbroek, P., Bracke, K., Temmerman, E., Vandervoort, J., Ludwig, A., Schacht, E.,
2002. Synthetic polyamines as vectors for gene delivery. 51,948-957.
Dubruel, P., Christiaens, B., Vanloo, B., Bracke, K., Rosseneu, M., Vandekerckhove, J., Schacht, E., 2003.
Physicochemical and biological evaluation of cationic polymethacrylates as vectors for gene delivery.
Eur.J.Pharm.Sci. 18,211-220.
Dubruel, P., Christiaens, B., Rosseneu, M., Vandekerckhove, J., Grooten, J., Goossens, V., Schacht, E., 2004.
Buffering properties of polmymethacrylates are not the only key to successful gene delivery. Biomacromolecules.
5,379-388.
Dunican, D.J., Doherty, P., 2001. Designing cell-permeant phosphopeptides to modulate intracellular signaling
pathways. Biopolymers 60,45-60.
Drin, G., Mazel, M., Clair, P., Mathieu, D., Kaczoreck, M., Temsamani, J., 2001. Physico-chemical requirements for
cellular uptake of pAntp peptide Role of lipid-binding affinity. Eur.J.Biochem. 268,1304-1314.
Drin, G., Cottin, S., Blanc, E., Rees, A.R., Temsamani, J., 2003. Studies on the internalization mechanism of cationic
cell-penetrating peptides. J.Biol.Chem. 278,31192-31201.
Felgner, P.L., Barenholz, Y., Behr, J.P., Cheng, S.H., Cullis, P., Huang, L., Jessee, J.A., Seymour, L., Szoka, F.,
Thierry, A.R., Wagner, E., Wagner, E., Wu, G., 1997. Nomenclature for synthetic gene delivery systems. Hum.Gene
Ther. 8,511-512.
Garnett, M.C., 1999. Gene-delivery systems using cationic polymers. Crit.Rev.Ther.Drug Carrier.Syst. 16,147-207.
Bijlage Doctoraatsthesis Bart Christiaens
Universiteit Gent 2004
13
Gebhart, C.L., Kabanov, A.V., 2001. Evaluation of polyplexes as gene transfer agents. J. Control. Release 73,401416.
Gevaert, K., De Mol, H., Puype, M., Houthaeye, T., De Boeck, S., Vandekerckhove, J., 1998. Sample preparation
procedures for ultrasensitive protein identification by PSD-MALDI-TOF mass spectrometry. J.Protein Chem. 17,560.
Godbey, W.T., Wu, K.K., Mikos, A.G., 1999a. Tracking the intracellular path of poly(ethylenimine)/DNA complexes for
gene delivery. Proc.Natl.Acad.Sci.U.S.A. 96,5177-5181.
Godbey, W.T., Wu, K.K., Mikos, A.G., 1999b. Size matters: molecular weight affects the efficiency of
poly(ethylenimine) as a gene delivery vehicle. J.Biomed.Mater.Res. 45,268-275.
Godbey,W.T., Barry,M.A., Saggau,P., Wu,K.K., Mikos,A.G., 2000. Poly(ethylenimine)-mediated transfection: a new
paradigm for gene delivery. J.Biomed.Mater.Res. 51, 321-328.
Godbey, W.T., Mikos, A.G., 2001a.
J.Control.Release. 72,115-125.
Recent progress in gene delivery using non-viral transfer complexes .
Godbey, W.T., Wu, K.K., Mikos, A.G., 2001b. Poly(ethylenimine)-mediated gene delivery affects endothelial cell
function and viability. Biomaterials. 22, 471-480.
Gratton, J.P., Yu, J., Griffith, J.W., Babbitt, R.W., Scotland, R.S., Hickey, R., Giordano, F.J., Sessa, W.C., 2003. Cellpermeable peptides improve cellular uptake and therapeutic gene delivery of replication-deficient viruses in cells and
in vivo. Nat.Med. 9,357-362.
Lindgren, M., Hallbrink, M., Prochiantz, A., Langel, U., 2000. Cell-penetrating peptides. Trends.Pharmacol.Sci.
21,99-103.
Nakanishi, M., Eguchi, A., Akuta, T., Nagoshi, E., Fujita, S., Okabe, J., Senda, T., Hasegawa, M., 2003. Basic
peptides as functional components of non-viral gene transfer vehicles. Curr.Protein Pept.Sci. 4,141-150.
Pooga, M., Soomets, U., Hallbrink, M., Valkna, A., Saar, K., Rezaei, K., Kahl, U., Hao, J., Wiesenfeld-Hallin, S.,
Hökfelt, T., Bartfai, T., Langel, U., 1998. Cell penetrating PNA constructs regulate galanin receptor levels and modify
pain transmission in vivo. Nat.Biotechnol. 16,857-861.
Pouton, C.W., Seymour, L.W., 2001. Key issues in non-viral gene delivery. Adv. Drug Deliver. Rev. 46,187-203.
Prochiantz A., 1996. Getting hydrophilic compounds into cells: lessons from homeopeptides. Curr.Opin.Neurobiol.
6,629-634.
Prochiantz, A., 1998. Peptide nucleic acid smugglers. Nat.Biotechnol. 16,819-820.
Rémy-Kristensen, A., Clamme, J.P., Vuilleumier, C., Kuhry, J.G., Mely, Y., 2001. Role of endocytosis in the
transfection of L929 fibroblasts by polyethylenimine/DNA complexes. Biochim.Biophys.Acta. 1514,21-32.
Schmidt-Wolf, G.D., Schmidt-Wolf, I.G., 2003. Non-viral and hybrid vectors in human gene therapy: an update.
Trends Mol.Med. 9,67-72.
Stephens, D.J., Pepperkok, R., 2001. The many ways to cross the plasma membrane. Proc.Natl.Acad.Sci U.S.A.
98,4295-4298.
Torchilin, V.P., Levchenko, T.S., Rammohan, R., Volodina, N., Papahadjopoulos-Sternberg, B., D'Souza, G.G., 2003.
Cell transfection in vitro and in vivo with nontoxic TAT peptide-liposome-DNA complexes. Proc.Natl.Acad.Sci U.S.A.
100,1972-1977.
Bijlage Doctoraatsthesis Bart Christiaens
Universiteit Gent 2004
14
Table 1
Polymer chemical composition, weight average molecular weight (Mw), polydispersity (d), mass per charge
Polymer
P(DMAEMA0.87-co-AEMA0.13)
P(DMAEMA0.48-co- AEMA0.42-co-HYMIMMA0.10)
Polyethylenimine
Mw (kDa)
d
Mass/charge (Da)
630
47
25
1.6
2.4
2.0
190
201
208
Table 2
β-Galactosidase mass, amount of cell protein and cell viability for transfection of Cos-1 cells with either free DNA (mock),
Lipofectamine™-DNA complexes or polymer-DNA complexes at increasing polymer-DNA charge ratio (ϕ). Data are reported as the
average ± standard deviation of three independent experiments.
Polyethylenimine
P(DMAEMA0.87-co-AEMA0.13)
P(DMAEMA0.48-co- AEMA0.42-co-HYMIMMA0.10)
ϕ
β-Gal
(ng/ml)
Cell
protein
(µg/ml)
Cell
viability
(%)
β-Gal
(ng/ml)
Cell
protein
(µg/ml)
Cell
viability
(%)
β-Gal
(ng/ml)
Cell
protein
(µg/ml)
Cell
viability
(%)
2
4
6
8
10
22.3 ± 1.5
9.3 ± 0.8
7.6 ± 0.7
6.7 ± 1.0
4.2 ± 0.9
22.2 ± 4.9
17.7 ± 1.0
8.7 ± 2.6
6.9 ± 1.9
5.1 ± 3.7
79 ± 6
65 ± 9
42 ± 4
36 ± 3
20 ± 1
5.1 ± 0.3
16.1 ± 0.5
14.5 ± 1.6
6.9 ± 0.9
1.8 ± 0.9
46.5 ± 1.9
51.2 ± 4.5
44.9 ± 3.6
24.0 ± 2.3
10.2 ± 5.1
100 ± 2
94 ± 6
97 ± 5
80 ± 2
68 ± 3
0.0± 0.1
1.6 ± 0.9
0.1 ± 0.1
0.1 ± 0.1
0.1 ± 0.1
47.4 ± 1.9
39.5 ± 2.6
45.9 ± 3.9
43.8 ± 2.7
44.5 ± 4.3
107 ± 1
97 ± 2
93 ± 3
90 ± 3
93 ± 7
0.1 ± 0.1
51.8 ± 5.4
100 ± 1
60.1 ± 22.5
19.6 ± 1.8
60 ± 2
Mock
Lipofectamine™
Bijlage Doctoraatsthesis Bart Christiaens
Universiteit Gent 2004
15
Figure legends
Figure 1: Chemical structure of P(DMAEMA0.87-co-AEMA0.13) (A), P(DMAEMA0.48-co-AEMA0.42co-HYMIMMA0.10) (B) and Penetratin peptide sequence (C).
Figure 2: Ethidium bromide fluorescence titration of free DNA ( ), P(DMAEMA0.87-coAEMA0.13)-DNA complexes prepared at a 2/1 () or a 4/1 () polymer-DNA charge ratio and
P(DMAEMA0.48-co-AEMA0.42-co-HYMIMMA0.10)-DNA complexes prepared at a 2/1 () or a 4/1
() polymer-DNA charge ratio, with Penetratin. Data are plotted as the percentage of free DNA
fluorescence ± standard deviation of three independent experiments. Insert: Agarose gel
electrophoresis of DNA, in the absence and presence of Penetratin.
Figure 3: β-Galactosidase expression as a function of the amount of Penetratin added to
P(DMAEMA0.87-co-AEMA0.13)-DNA complexes (A) and to P(DMAEMA0.48-co-AEMA0.42-coHYMIMMA0.10)-DNA complexes (B), prepared at a 2/1 (left bar) or a 4/1 (right bar) polymer-DNA
charge ratio (+/-). Data are reported as the average ± standard deviation of three independent
experiments.
Figure 4: Subcellular localisation of P(DMAEMA0.87-co-AEMA0.13)-DNA complexes prepared at a
2/1 polymer-DNA charge ratio (A) and a 4/1 polymer-DNA charge ratio (B) in the absence and
presence of Penetratin, as determined by confocal microscopy on Cos-1 cells incubated at 37
°C. Red fluorescence corresponds to the LysoTracker Red DND-99 probe, green fluorescence
corresponds to Oregon Green 488-X labelled P(DMAEMA0.87-co-AEMA0.13)-DNA complexes.
Figure 5:
Subcellular localisation of P(DMAEMA0.48-co-AEMA0.42-co-HYMIMMA0.10)-DNA
complexes prepared at a 4/1 polymer-DNA charge ratio in the absence and presence of
Penetratin, as determined by confocal microscopy on Cos-1 cells incubated at 37 °C. Red
fluorescence corresponds to the LysoTracker Red DND-99 probe, green fluorescence
corresponds to Oregon Green 488-X labelled P(DMAEMA0.48-co-AEMA0.42-co-HYMIMMA0.10)DNA complexes.
Figure 6: Subcellular localisation of NBD-labelled Penetratin (10 µM) added to P(DMAEMA0.87co-AEMA0.13)-DNA complexes prepared at a 2/1 polymer-DNA charge ratio, as determined by
confocal microscopy on Cos-1 cells incubated at 37 °C. Red fluorescence corresponds to the
LysoTracker Red DND-99 probe, green fluorescence corresponds to NBD-labelled Penetratin.
16
Figure 1
A
CH3
C O
C O
O
O
CH2
CH2
CH2
CH2
N
NH2
H3C
B
CH3
CH3
CH3
CH3
[ CH2 C ]0.48 [ CH2 C ]0.42
H3C
C
CH3
[ CH2 C ]0.87 [ CH2 C ]0.13
[ CH2 C ]0.10
C O
C O
C O
O
O
O
CH2
CH2
CH2
CH2
N
NH2
CH3
CH2
H3C
N
NH
H2N-RQIKIWFQNRRMKWKK-CONH2
Figure 2
17
Figure 3
18
Figure 4
19
Figure 5
Figure 6
20
5
Samenvatting en besluiten
81
Penetratin is het celpenetrerende peptide dat is afgeleid van het DNA-bindende
homeodomein van het Antennapedia homeoproteïne uit Drosophila. Net als
homeoproteïnen, is dit 16 aminozuren lange peptide in staat om op een endocytoseonafhankelijke manier te internaliseren in eukaryote cellen. Daarom wordt het
gebruikt als vector voor het binnenbrengen van hydrofiele cargomoleculen. Ondanks
het uitgebreide toepassingsgebied, blijft het internaliseringsmechanisme van
celpenetrerende peptiden echter onduidelijk. Op basis van de endocytose- en receptoronafhankelijke opname van het Penetratin peptide, werd gesuggereerd dat deze
internalisering kan gebeuren door een directe interactie van Penetratin met de
plasmamembraan, gevolgd door translocatie van Penetratin en de daaraan gekoppelde
cargo in het cytosol (Derossi et al., 1996; Prochiantz, 1996) (Fig. 11, pag. 43).
Om de membraantranslocatie van Penetratin peptiden te verklaren, werden de
interacties van deze peptiden met de lipidendubbellaag van unilamellaire vesikels en
met MDCK cellen onderzocht. Door synthese van nieuwe Penetratin varianten werd
de specifieke bijdrage en het relatieve belang van de tryptofaan residu’s (Trp48 en
Trp56), de positief geladen residu’s, de amfipaticiteit en de elektrostatische en
hydrofobe interacties bestudeerd.
In het eerste deel van dit werk, werd de interactie van Penetratin peptiden met negatief
geladen fosfolipidenvesikels aangetoond door fysicochemische technieken. Dit
bevestigt de hypothese van Prochiantz et al., die berust op directe interacties van
Penetratin met de plasmamembraan (Derossi et al., 1996; Prochiantz, 1996).
Overeenkomstig het peptide-lipide interactiemodel van White en Wimley (Fig. 7, pag.
34) (White et al., 2001), associëren random gestructureerde Penetratin monomeren
initieel met lipidendubbellagen door elektrostatische interacties tussen de positief
geladen aminozuurresidu’s van Penetratin en negatief geladen fosfolipidehoofdgroepen
in de lipidendubbellaag.
De peptiden dringen vervolgens binnen in de
lipidendubbellaag, waardoor de α -helicale secundaire structuur van de
lipidengebonden Penetratin peptiden geïnduceerd wordt.
De Penetratin helices zijn schuin georiënteerd in de lipidendubbellaag, ter hoogte van
het water-lipiden grensvlak. Hierbij is Trp48 dieper geborgen in de lipidendubbellaag
82
dan Trp56. In tegenstelling tot gekende membraandestabiliserende peptiden (bvb.
Melittin), permeabiliseren Penetratin peptiden de lipidendubbellaag slechts in een
beperkte mate. Dit verklaart waarom Penetratin peptiden niet toxisch zijn voor cellen.
De membraandestabilisatie is afhankelijk van de insertiediepte van de peptiden in de
lipidendubbellaag. Deze insertie wordt gedreven door het hydrofoob effect en is
afhankelijk van de hydrofobe omgeving van Trp56, die bepaald wordt door residu’s
Arg52, Arg53, Lys55 en Lys57. Ondanks hun lagere affiniteit, vertonen Penetratin
varianten met dubbele substituties van deze positief geladen residu’s door alanine
(R53A/K57A en R52A/K55A), een toename in de membraanpermeabilisatie van
fosfolipidenvesikels (Fig. 14, pag. 67). Dit is het gevolg van een diepere insertie van
deze Penetratin varianten in de hydrofobe kern van de lipidendubbellaag, in
vergelijking met wild type Penetratin. De enkelvoudige W48F en W56F substituties
hebben een minimale invloed op de interactie van Penetratin peptiden met
fosfolipidenvesikels.
De endocytose-onafhankelijke internalisering van Penetratin peptiden die in dit werk
bij 4°C werd geobserveerd in MDCK cellen, toont het bestaan van de
membraantranslocatie van Penetratin peptiden verder aan. Deze internalisering blijkt
ook afhankelijk te zijn van de hydrofobe omgeving van Trp56. De K46A/K57A,
R53A/K57A en R52A/K55A varianten, waarbij een arginine of lysine residu naast
Trp56 gesubstitueerd werd door een alanine, worden bij 4°C geïnternaliseerd in het
cytosol van MDCK cellen, met een efficiëntie die vergelijkbaar is met die van wild
type Penetratin. De fysicochemische data (cf. supra), suggereren dat de verminderde
initiële elektrostatische binding van deze varianten met celmembranen, wordt
gecompenseerd door hun verhoogde membraandestabiliserende eigenschappen. Dit
resulteert in een opname-efficiëntie vergelijkbaar met die van wild type Penetratin. Dit
is niet het geval voor de K46A/R53A variant, die extracellulair associeert met het
celoppervlak.
In dit werk werd ook aangetoond dat residu Trp48 functioneel belangrijk is voor de
endocytose-onafhankelijke internalisering van Penetratin peptiden in cellen. De W48F
variant wordt immers minder geïnternaliseerd dan wild type en W56F Penetratin. Dit
83
stemt overeen met de hoge conserveringsgraad (>95% bij 346 homeodomeinen) van
dit residu (Gehring et al., 1994a).
Bij 37°C is de opname-efficiëntie van Penetratin peptiden in MDCK cellen 10 keer
hoger dan bij 4°C. Confocale microscopie toonde bovendien aan dat Penetratin
peptiden bij 37°C vooral door endocytose worden opgenomen.
De efficiënte
internalisering bij 37°C kan dus niet enkel verklaard worden door de translocatie van
de Penetratin peptiden doorheen de plasmamembraan. Op basis van de bovenstaande
resultaten kan het opnamemechanisme als volgt voorgesteld worden (Fig. 16).
Figuur 16. De internalisering van Penetratin peptiden door translocatie doorheen de
plasmamembraan (A) en door endocytose, met translocatie doorheen de endolysosomale
membraan (B). Penetratin peptiden worden bij 37°C door beide mechanismen opgenomen (A & B),
terwijl ze bij 4°C enkel door membraantranslocatie opgenomen worden (A).
Ten gevolge van elektrostatische interacties associëren de positief geladen Penetratin
peptiden met het negatief geladen celoppervlak. Enerzijds worden Penetratin peptiden
84
opgenomen door translocatie doorheen de plasmamembraan. Deze endocytoseonafhankelijke internalisering verklaart de opname bij 4°C (Fig. 16-A).
Daarnaast worden Penetratin peptiden bij 37°C ook opgenomen door endocytose (Fig.
16-A&B). Door interacties met de endolysosomale membraan zijn Penetratin peptiden
vervolgens in staat om naar het cytosol te transloceren. Daardoor wordt lysosomale
afbraak vermeden, wat resulteert in een hoge opname-efficiëntie.
Het internaliseringsmechanisme kan verder celtype-afhankelijk zijn, zoals
gesuggereerd door de uniforme verdeling van Penetratin peptiden die werd
waargenomen in levende primaire ratneuronen (Fig. 15, pag. 71).
Het bovenstaande model wordt bevestigd door de toename van de transfectieefficiëntie van polymethacrylaat-DNA complexen in Cos-1 cellen, die geobserveerd
werd door additie van Penetratin.
Polymethacrylaten zijn kationische polymeren die inter-poly-elektrolietcomplexen
(IPEC) vormen met DNA, waardoor de opname in cellen mogelijk wordt (Fig. 13, pag.
52). Ondanks de buffering van de endosomale pH, hebben deze polymethacrylaten een
lage transfectie-efficiëntie in vergelijking met andere transfectievectoren, zoals
polyethyleenimine (PEI) en Lipofectamine™.
In dit werk werd door confocale
microscopie aangetoond dat de polymethacrylaat-DNA complexen door endocytose
worden geïnternaliseerd in Cos-1 cellen. De complexen zijn echter niet in staat om uit
de endolysosomen te ontsnappen. Gezien de lage toxiciteit van de complexen, kan dit
te wijten zijn aan beperkte membraaninteracties van polymethacrylaten.
Door de membraaninteragerende eigenschappen van Penetratin te combineren met de
DNA-condenserende eigenschappen van polymethacrylaten, werden hogere
transfectie-efficiënties bekomen. Penetratin wordt, samen met de polymethacrylaatDNA complexen, door endocytose opgenomen door Cos-1 cellen. Doordat Penetratin
het ontsnappen van de polymethacrylaat-DNA complexen uit de endolysosomen
versnelt, hebben polymethacrylaat-DNA-Penetratin complexen transfectie-efficiënties
die vergelijkbaar zijn met die van polyethyleenimine (PEI) en Lipofectamine™.
Desondanks blijven polymethacrylaat-DNA-Penetratin complexen niet toxisch voor
Cos-1 cellen.
Naast de DNA-condensatie en endosomale buffering, zijn
85
membraaninteracties dus ook kritisch voor de transfectie van Cos-1 cellen door
polymethacrylaten.
Gratton et al. toonden recent aan dat Penetratin additie ook de virale transfectieefficiëntie verhoogt (Gratton et al., 2003). Het membraaninteragerende, niet toxische
Penetratin peptide kan dus gebruikt worden om de transfectie-efficiëntie van zowel
synthetische als virale transfectievectoren te verhogen.
86
English summary
Cellular internalisation of Penetratin peptides and application for DNAtransfections
Cell penetrating peptides (CPP) are water soluble, non-toxic peptides, used for the
internalisation of hydrophilic cargo molecules into eukaryotic cells. Penetratin is a 16residue cell penetrating peptide (RQIKIWFQNRRMKWKK), corresponding to
residues 43-58 of helix 3 of the DNA-binding domain of Atennapedia, a Drosophila
homeoprotein (Derossi et al., 1994 and 1996; Prochiantz, 1999). Homeoprotein
transcription factors play an essential role during several steps of the developmental
process and some of these proteins are even expressed throughout adulthood.
Homeoproteins also function as paracrine ‘messenger proteins’, that are intercellularly
exchanged via secretion- and internalisation mechanisms, which remain unclear
(Prochiantz and Joliot, 2003; Joliot and Prochiantz, 2004).
Similarly to
homeoproteins, Penetratin peptides are efficiently internalised in cells through energyindependent mechanisms (Derossi et al., 1994; Lundberg and Langel, 2003;
Prochiantz, 1999).
Despite the wide application field of the Penetratin vector, its internalisation
mechanism has yet to be unravelled. According to Prochiantz et al., Penetratin
interacts directly with the plasma membrane, followed by translocation into the cytosol
through the formation of inverted micelles in the lipid bilayer of cellular membranes
(Prochiantz, 1996; Derossi et al., 1998a; Prochiantz, 1999) (Fig. 11, page 43).
Although this hypothetical model accounts for the cellular internalisation of small
hydrophilic compounds (peptides, antisense oligonucleotides, drugs, etc.), it does not
explain the internalisation of full-length homeoproteins, considered to be natural fusion
proteins.
87
The first aim of this thesis was to characterise the internalisation mechanism of the
Penetratin peptide, thus improving the understanding of the internalisation of
homeoproteins and CPP in general.
The peptide characteristics determining the Penetratin interaction with lipid bilayers
and with living cells were identified through the synthesis of new Penetratin variants.
According to Derossi et al., Trp48 and Trp56 play a key role in the cellular
internalisation of Penetratin peptides (Derossi et al., 1994). Since tryptophan residues
are known to favour peptide-lipid interactions (Wimley and White, 1996), the specific
contribution of Trp48 and Trp56 was assessed by synthesis of the single W48F- and
W56F-Penetratin variants. At physiological pH, Penetratin is positively charged (pI =
12.3) due to the presence of basic arginine and lysine residues. To investigate the
relative importance of these residues, as well as peptide amphipathicity and
electrostatic and hydrophobic interactions, the K46A/R53A, K46A/K57A,
R53A/K57A and R52A/K55A Penetratin variants were synthesised.
In this work, physicochemical techniques have been used to demonstrate Penetratin
interactions with phospholipid vesicles, confirming the model proposed by Prochiantz
et al. (Prochiantz, 1996; Derossi et al., 1996). In accordance with the White and
Wimley peptide-lipid interaction model (Fig. 7, page 34) (White and Wimley, 1999;
White et al., 2001), the initial binding of Penetratin monomers to lipid bilayers is
driven by electrostatic interactions between the positively charged peptide residues and
negatively charged phospholipid head groups. Subsequently, lipid binding induces the
α-helical secondary structure of the peptides. The Penetratin helices remain close to
the water-lipid interface, in a tilted orientation with a deeper insertion of Trp48
compared to Trp56. The limited membrane permeabilisation of Penetratin peptides
accounts for their low cellular toxicity and indicates that these peptides do not behave
like ‘classical’ membrane destabilising peptides (e.g. Melittin).
Penetratin membrane destabilisation is reliant on the depth of insertion into the lipid
bilayer. This insertion is driven by the hydrophobic effect and depends on the
hydrophobic environment of Trp56, and especially on residues Arg52, Arg53, Lys55
and Lys57. Despite a lower affinity, Penetratin variants with double substitutions of
these positively charged residues to alanine (R53A/K57A and R52A/K55A), have
88
increased membrane permeabilisation properties compared to wild type Penetratin, due
to a deeper insertion into the hydrophobic core of the lipid bilayer (Fig 14, page 67).
The single W48F and W56F substitutions have minor influence on Penetratin-lipid
interactions.
In the current work, membrane translocation of Penetratin peptides was further
supported by their endocytosis-independent internalisation into MDCK cells at 4°C.
Such internalisation was dependent upon the hydrophobic environment of Trp56. At
4°C, the K46A/K57A, R53A/K57A and R52A/K55A variants with a substitution of
one arginine or lysine residue flanking Trp56 to alanine had similar cellular uptake
efficiency as wild type Penetratin. The physicochemical data (cf. supra) suggest that
increased destabilisation of cellular membranes compensates for a decreased initial
electrostatic binding of the R53A/K57A and R52A/K55A variants, thus resulting in
uptake efficiencies comparable to wild type Penetratin. This is not the case for the
K46A/R53A variant, which remains extracellularly associated with the cell surface.
The functional importance of the Trp48 residue compared to Trp56 is stressed by the
W48F susbstitution, which affected endocytosis-independent uptake at 4°C more than
the W56F substitution. The high degree of conservation of Trp48 among 346
homeodomains (>95%) further supports this concept (Gehring et al., 1994a).
At 37°C, the internalisation efficiency of Penetratin peptides into MDCK cells was ten
times higher than at 4°C. Confocal microscopy moreover showed that Penetratin
peptides are mainly internalised by endocytosis at that temperature. Plasma membrane
translocation alone thus cannot fully account for the efficient internalisation of
Penetratin peptides.
Based upon these results, the efficient cellular internalisation of Penetratin peptides can
be explained as follows (Fig. 16, page 84).
Penetratin peptides initially bind
electrostatically to the cell surface and are then taken up by plasma membrane
translocation. This endocytosis-independent internalisation accounts for cellular
uptake at 4°C (Fig. 16-A), while at 37°C the cell surface-associated positively charged
Penetratin peptides are further taken up by endocytosis (Fig. 16-A&B). Due to
89
interactions with the endolysosomal membrane, Penetratin peptides are able to
translocate to the cytosol, so avoiding lysosomal degradation.
The internalisation mechanism might further depend on the cell type, as indicated by
the uniform distribution of Penetratin peptides observed in living primary rat neurons
at 37°C (Fig. 15, page 71).
This model for the cellular uptake of Penetratin peptides is supported by the increased
transfection efficiency of polymethacrylate-DNA complexes in Cos-1 cells, upon
addition of Penetratin.
Since the spontaneous cellular uptake of polynucleotides is hampered by their negative
charge and large hydrodynamic volume and by nuclease degradation, they must be
combined with a synthetic or viral transfection vector (Garnett, 1999; Bally et al.,
1999). Cationic polymethacrylates are vinyl-based polymers that form inter-polyelectrolyte complexes (IPEC) with negatively charged DNA, inducing DNAcondensation and protecting the DNA against nuclease degradation (Fig. 13, pag. 52)
(Dubruel et al., 2000 en 2002). Despite the buffering capacity in the endosomal pH
range (pH 5.5-7.4), the transfection efficiency of polymethacrylates remains lower than
that of the polyethylenimine (PEI) proton sponge (Behr, 1997) and Lipofectamine.
Confocal microscopy showed that Cos-1 cellular uptake and endosomal escape of
polymethacrylate-DNA complexes is slow compared to PEI. In contrast to PEI,
polymethacrylates are neither haemolytic, nor cytotoxic, suggesting that the low
transfection efficiency might be attributable to low membrane interactions of the
polymethacrylates.
In order to increase the transfection efficiency of polymethacrylates, we combined
their DNA condensation properties with the membrane translocation properties of the
Penetratin peptide. Polymethacrylate-DNA-Penetratin complexes are internalised by
endocytosis.
Penetratin further enhances the endolysosomal escape of the
polymethacrylate-DNA complexes, yielding transfection efficiencies comparable to
that of PEI and Lipofectamine, while the cellular toxicity remains low. These data
clearly demonstrate that besides DNA condensation and endosomale buffering,
membrane interactions are also critical for polymethacrylate-mediated transfection into
Cos-1 cells, in accordance with Gratton et al. whom recently enhanced viral gene
90
delivery using Penetratin (Gratton et al., 2003).
In conclusion these results
demonstrate that the membrane interacting and non-toxic properties of the Penetratin
peptide can be used to enhance the transfection efficiency of both synthetic and viral
gene delivery.
The results of this work have been published in international, specialised journals (see
appendices of chapters 3 and 4).
Translation of the cited figure legends:
Figure 7, page 34.
Schematical representation of peptide insertions into lipid bilayers (White et al., 2001). This cartoon is
based on the 4-step thermodynamic model of Wimley and White for binding (1), folding (2), insertion (3)
en aggregation (4) of α-helical membrane interacting peptides.
Figure 11, page 43.
Penetratin membrane translocation model, as proposed by Prochiantz et al. (Prochiantz, 1996).
Figure 14, page 67.
A, 3D structure of wild type Penetratin, obtained from the NMR structure of the Antennapedia
homeodomain, complexed with DNA (PDB code 1ahd, model 1, residues 43-58); B, Summary and
schematical representation of the interactions of wild type and variant Penetratin peptides with
negatively charged phospholipid membranes.
Figure 15, page 71.
A, Epifluorescence microscopy of fixed MDCK cells, incubated for 30 min. with 5 µM biotinylated wild
type Penetratin at 4°C, after fixation in ethanol/acetic acid and detected with Streptavidine-FITC; B,
Confocal microscopy of living primary rat neurons, incubated for 30 min. with 10 µM NBD-labelled
wild type Penetratin at 37°C (Right: phase-contrast image; left: fluorescence image, green corresponds
to NBD fluorescence).
Figure 16, page 84.
The internalisation of Penetratin peptides by plasma membrane translocation (A) and by endocytosis,
followed by translocation through the endolysosomal membrane (B). At 37°C, Penetratin peptides are
internalised by both mechanisms (A & B), while at 4°C only membrane translocation occurs (A).
91
Publicatielijst - List of publications
Headgroup specificity of lecithin cholesterol acyltransferase for monomeric and vesicular phospholipids
Christiaens B., Vanloo B., Gouyette C., Van Vynckt I., Caster H., Taveirne J., Verhee A., Labeur C., Peelman F., Vandekerckhove
J., Tavernier J. and Rosseneu M.
Biochimica et Biophysica Acta - Molecular and Cell Biology of Lipids 1486 (2000) 321-327
Tryptophan fluorescence study on the interaction of Penetratin peptides with model membranes
Christiaens B., Symoens S., Vanderheyden S., Engelborghs Y., Joliot A., Prochiantz A., Vandekerckhove J., Rosseneu M. and
Vanloo B.
European Journal of Biochemistry 269 (2002) 2918-2926
Abstract from the 43rd International Conference on the Bioscience of Lipids - Lipid bilayer destabilization by Penetratin
peptides
Christiaens B., Joliot A., Prochiantz A., Vandekerckhove J., Vanloo B. and Rosseneu M.
Chemistry and Physics of Lipids 118 (2002) 45
Physicochemical and biological evaluation of cationic polymethacrylates as vectors for gene delivery
Dubruel P., Christiaens B., Vanloo B., Bracke K., Rosseneu M., Vandekerckhove J. and Schacht E.
European Journal of Pharmaceutical Sciences 18,3-4 (2003) 211-220
Abstract from the 4th European Biophysics Congress - Study of membrane destabilisation by Penetratin peptides
Christiaens B., Joliot A., Prochiantz A., Vandekerckhove J., Vanloo B. and Rosseneu M.
European Biophysics Journal 32 (2003) 196
Poly-L-glutamic derivatives as multifunctional vectors for gene delivery – part B: biological evaluation
Dekie L., Dubruel P., Christiaens B., Vanloo B., Rosseneu M., Vandekerckhove J., Mannisto M., Urtti A. and Schacht E.
BiomacromoIecules 4 (2003) 1177-1183
The buffering properties of cationic polymethacrylates are not the only key to successful gene delivery
Dubruel P., Christiaens B., Rosseneu M., Vandekerckhove J., Goossens V. and Schacht E.
Biomacromolecules 5 (2004) 379-388
Expression and activity of the nucleotide binding domains of the human ABC-A1 transporter
Roosbeek S., Caster H., Liu Qing Z., Berne P.-F., Duverger N., Christiaens B., Vandekerckhove J., Peelman F., Labeur C. and
Rosseneu M.
Protein Expression and Purification 35 (2004) 102-110
Membrane interaction and cellular internalisation of Penetratin peptides
Christiaens B., Grooten J., Reusens M., Joliot A., Goethals M., Vandekerckhove J., Prochiantz A. and Rosseneu M.
European Journal of Biochemistry 271 (2004) 1187-1197
The Penetratin peptide facilitates gene delivery by cationic polymethacrylates
Christiaens B., Dubruel P., Grooten J., Vandekerckhove J., Rosseneu M. and Schacht E.
Accepted for publication in European Journal of Pharmaceutical Sciences
Penetratin-membrane association studied by molecular dynamics simulations: W48/R52/W56 form a cation/Π cluster
shielding the peptide from the aqueous phase
Lensink M., Christiaens B., Vandekerckhove J., Prochiantz A. and Rosseneu M.
Accepted for publication in Journal of Molecular Biology
92
Dankwoord - Acknowledgements
Ik zou dit proefschrift willen afsluiten met een dankwoord, misschien wel het
belangrijkste hoofdstuk van deze thesis. Een doctoraat voltooi je immers nooit door
een aantal jaar in je eentje te experimenteren, maar door samen te werken met een hele
groep mensen.
Vooreerst bedank ik de academici die betrokken waren bij dit werk. Ik dank mijn
promotor Prof. Joël Vandekerckhove, om dit werk in zijn vakgroep te mogen
uitvoeren. Ik dank mijn co-promotor Prof. Maryvonne Rosseneu, voor de kans die ze
me gaf om dit doctoraatswerk te voltooien, voor haar deskundige begeleiding en voor
de interesse in dit werk. De afgelopen vijf jaartjes heb ik als zeer leerrijk ervaren. Ze
zullen me in toekomst zeker verder inspireren. Ik dank Prof. Etienne Schacht voor de
interesse in dit werk en voor het tot stand brengen van onze interdisciplinaire
samenwerking. Binnen dit polymeerkader dank ik ook Dr. Peter Dubruel voor zijn
nooit aflatend enthousiasme bij het transfecteren en tijdens de vele donkere uurtjes
confocale microscopie, waarin we worstelden om protonensponsen en penetrerende
peptiden in al dan niet esthetisch verantwoorde cellen binnen te krijgen.
Daarnaast bedank ik ook hen die infrastructuur, materialen en kennis ter beschikking
stelden: Dr. Marc Goethals voor de deskundige synthese van de peptiden; Prof. Jan
Tavernier en Dr. José Van der Heyden voor het gebruik van de FACS; Prof. Johan
Grooten en Dr. Vera Goosens voor het gebruik van de confocale microscoop; Prof.
Yves Engelborhs, Stef en Mario van de KULeuven voor de tryptofaan
leeftijdsmetingen; Dr. Xaveer Van Ostade voor de elektroporatie van de E. coli. Je
tiens à remercier Prof. Alain Prochiantz et Prof. Alain Joliot pour leur hospitalité
pendant les stages dans leur labo. Je remercie spécialement Dr. Edmond Dupont, pour
l’accompagnement excellent pendant ‘le manip des cellules’ et pour sa gentillesse et
pour la bonne compagnie pendant ces séjours.
Ik dank het Instituut voor de aanmoediging van Innovatie door Wetenschap en
Technologie in Vlaanderen (IWT-Vlaanderen) voor de financiële ondersteuning van
dit werk.
93
Dit werk zou ook nooit tot stand gekomen zijn zonder de collegialiteit van de
medewerkers van het Labo der Leuke Lipo’s in de Hospitaalstraat 13. Claudia Braet
bewonder ik voor haar organisatorisch talent bij het arrangeren van al den
administratieve bazaar, maar vooral voor het aangename gezelschap en de sympathieke
glimlach... Hans Caster dank ik voor het deskundig en zorgzaam uitvoeren van de
chromatografie, voor de technische discussies en ook voor het amusement tijdens de
pseudo-wetenschappelijke activiteiten zoals het (blijven) verhuizen van allerlei
labomateriaal. Marc Lensinck dank ik voor de mooie Penetratin figuurtjes die hij uit
zijn computer kan toveren.
Ik dank Frank, aka. doctor Peelman, voor de
wetenschappelijke en kritische discussies, voor de wilde verhalen over gigantische
karpers die zelden bijten, over frigogeile katten, over de avontuurlijke reizen met zijn
lief lief Sophie,... Berlinda Vanloo dank ik voor de optimale begeleiding gedurende
mijn eerste jaartjes in het labo, voor de vele vruchtbare discussies, voor de blijvende
interesse in de Penetratin-lipide interacties en ‘Ja jong...’ ook voor de minder
gespannen momenten met verhaaltjes over ‘de aanleg van Claude zijne vijver en de
fratsen van onze Jan en ons Veerle’... De (ex)collega’s doctoraatstudenten, Stein
Roosbeek, Nathalie Demeester en Inge Van Vynckt dank ik voor de vlotte
samenwerking en de soms heftige discussies en vooral voor de vele leuke momenten
binnen en buiten ‘t labo.
Ik dank mijn vriendjes en vriendinnekes, voor de leuke tijden die ik buiten het labo
doorbracht. In het bijzonder Beeske, Nijn en Molleke... voor de vrijetijdsbestedingen,
het maken van amuseleute en het filosoferen bij een hapje en vooral een drankje en
voor al de rest... Ge weet wel hé ;-)
Ik dank mijn ma en pa, mijn broerke Wim en mijn drie suikernonkels Lucien, Roger en
Ronny voor de liefdevolle steun en voor de leuke momenten aan het thuisfront in
Brakel. Tenslotte wens ik deze thesis op te dragen aan memé, die er helaas niet meer
bij kon zijn, maar die altijd apetrots was op haar studerende oogappels...
Bedankt!
94
Literatuurverwijzingen - References
Avanti Polar Lipids website: www.avantilipids.com
Natural Lipids (2004).
Ahmad, I., Longenecker, M., Samuel, J., and Allen, T.M.(1993). Antibody-targeted delivery of doxorubicin entrapped in sterically
stabilized liposomes can eradicate lung cancer in mice. Cancer Res. 53, 1484-1488.
Alberts, B., Bray, D., Lewis, J., Raff, M., Roberts, K., and Watson, J.D.(1994). Molecular Biology of the Cell, third edition.
Garland Publishing (Taylor and Francis group), New York, NY 10003.
Allinquant, B., Hantraye, P., Mailleux, P., Moya, K., Bouillot, C., and Prochiantz, A.(1995). Downregulation of amyloid precursor
protein inhibits neurite outgrowth in vitro. J.Cell Biol. 128, 919-927.
Andersson, A., Almqvist, J., Hagn, F., and Maler, L.(2004). Diffusion and dynamics of penetratin in different membrane
mimicking media. Biochim.Biophys.Acta 1661, 18-25.
Arnt, C.R., Chiorean, M.V., Heldebrant, M.P., Gores, G.J., and Kaufmann, S.H.(2002). Synthetic Smac/DIABLO peptides
enhance the effects of chemotherapeutic agents by binding XIAP and cIAP1 in situ. J.Biol.Chem. 277, 44236-44243.
Aullo, P., Giry, M., Olsnes, S., Popoff, M.R., Kocks, C., and Boquet, P.(1993). A chimeric toxin to study the role of the 21 kDa
GTP binding protein rho in the control of actin microfilament assembly. EMBO J. 12, 921-931.
Axelrod, H.R., Sofia, M.J., and Walker, S.(1998). Chemistry and cellular aspects of cationic facial amphiphiles. Adv.Drug
Deliv.Rev 30, 61-71.
Bally, M.B., Harvie, P., Wong, F.M., Kong, S., Wasan, E.K., and Reimer, D.L.(1999). Biological barriers to cellular delivery of
lipid-based DNA carriers. Adv.Drug Deliv.Rev 38, 291-315.
Barry, M.A., Dower, W.J., and Johnston, S.A.(1996). Toward cell-targeting gene therapy vectors: selection of cell-binding
peptides from random peptide-presenting phage libraries. Nat.Med. 2, 299-305.
Batrakova, E.V., Dorodnych, T.Y., Klinskii, E.Y., Kliushnenkova, E.N., Shemchukova, O.B., Goncharova, O.N., Arjakov, S.A.,
Alakhov, V.Y., and Kabanov, A.V.(1996). Anthracycline antibiotics non-covalently incorporated into the block
copolymer micelles: in vivo evaluation of anti-cancer activity. Br.J.Cancer 74, 1545-1552.
Behr, J.P.(1994). Gene transfer with synthetic cationic amphiphiles: prospects for gene therapy. Bioconjug.Chem. 5, 382-389.
Behr, J.P.(1997). The proton sponge: a trick to enter cells the viruses did not exploit. Chimica 51, 34-36.(Abstract)
Bellet-Amalric, E., Blaudez, D., Desbat, B., Graner, F., Gauthier, F., and Renault, A.(2000). Interaction of the third helix of
Antennapedia homeodoain and a phospholipid monolayer, studied by ellipsometry and PM-IRRAS at the air-water
interface. Biochim.Biophys.Acta 1467, 131-143.(Abstract)
Bennett, M.R., Farnell, L., Gibson, W.G., Lin, Y.Q., and Blair, D.H.(2001). Quantal and non-quantal current and potential fields
around individual sympathetic varicosities on release of ATP. Biophys.J. 80, 1311-1328.
Bentz, J., Ellens, H., and Szoka, F.C.(1987). Destabilization of phosphatidylethanolamine-containing liposomes: hexagonal phase
and asymmetric membranes. Biochemistry 26, 2105-2116.
Berlose, J.P., Convert, O., Derossi, D., Brunissen, A., and Chassaing, G.(1996). Conformational and associative behaviours of the
third helix of antennapedia homeodomain in membrane-mimetic environments. Eur.J.Biochem. 242, 372-386.
Berthet, C., Guehenneux, F., Revol, V., Samarut, C., Lukaszewicz, A., Dehay, C., Dumontet, C., Magaud, J.P., and Rouault,
J.P.(2002). Interaction of PRMT1 with BTG/TOB proteins in cell signalling: molecular analysis and functional aspects.
Genes Cells 7, 29-39.
Bieber, T., Meissner, W., Kostin, S., Niemann, A., and Elsasser, H.P.(2002). Intracellular route and transcriptional competence of
polyethylenimine-DNA complexes. J.Control.Release. 82, 441-454.
Billeter, M., Qian, Y., Otting, G., Muller, M., Gehring, W.J., and Wuthrich, K.(1990). Determination of the three-dimensional
structure of the Antennapedia homeodomain from Drosophila in solution by 1H nuclear magnetic resonance
spectroscopy. J.Mol.Biol. 214, 183-197.
95
Binder, H. and Lindblom, G.(2003). Charge-dependent translocation of the Trojan peptide penetratin across lipid membranes.
Biophys.J.. 85, 982-995.
Blair, D.H., Robson, S., King, G., and Bennett, M.R.(2001). Vesicle-associated proteins and transmitter release from sympathetic
ganglionic boutons. Neuroreport. 12, 607-610.
Bloch-Gallego, E., Le Roux, I., Joliot, A.H., Volovitch, M., Henderson, C.E., and Prochiantz, A.(1993). Antennapedia homeobox
peptide enhances growth and branching of embryonic chicken motoneurons in vitro. J.Cell Biol. 120, 485-492.
Borasio, G.D., John, J., Wittinghofer, A., Barde, Y.A., Sendtner, M., and Heumann, R.(1989). ras p21 protein promotes survival
and fiber outgrowth of cultured embryonic neurons. Neuron 2, 1087-1096.
Boussif, O., Lezoualc'h, F., Zanta, M.A., Mergny, M.D., Scherman, D., Demeneix, B., and Behr, J.P.(1995). A versatile vector for
gene and oligonucleotide transfer into cells in culture and in vivo: polyethylenimine. Proc.Natl.Acad.Sci.U.S.A. 92,
7297-7301.
Brasseur, R., Pillot, T., Lins, L., Vandekerckhove, J., and Rosseneu, M.(1997). Peptides in membranes: tipping the balance of
membrane stability. Trends Biochem.Sci 22, 167-171.
Brattwall, C.E., Lincoln, P., and Norden, B.(2003). Orientation and conformation of cell-penetrating Peptide penetratin in
phospholipid vesicle membranes determined by polarized-light spectroscopy. J.Am.Chem.Soc. 125, 14214-14215.
Braun, K., Peschke, P., Pipkorn, R., Lampel, S., Wachsmuth, M., Waldeck, W., Friedrich, E., and Debus, J.(2002). A biological
transporter for the delivery of peptide nucleic acids (PNAs) to the nuclear compartment of living cells. J.Mol.Biol. 318,
237-243.
Brown, D.A. and London, E.(1998). Functions of lipid rafts in biological membranes. Annu.Rev.Cell Dev.Biol. 14, 111-136.
Chatelin, L., Volovitch, M., Joliot, A.H., Perez, F., and Prochiantz, A.(1996). Transcription factor hoxa-5 is taken up by cells in
culture and conveyed to their nuclei. Mech.Dev. 55, 111-117.
Chen, Y. and Barkley, M.D.(1998). Toward understanding tryptophan fluorescence in proteins. Biochemistry 37, 9976-9982.
Chen, Y.N., Sharma, S.K., Ramsey, T.M., Jiang, L., Martin, M.S., Baker, K., Adams, P.D., Bair, K.W., and Kaelin, W.G.J.(1999).
Selective killing of transformed cells by cyclin/cyclin-dependent kinase 2 antagonists. Proc.Natl.Acad.Sci U.S.A. 96,
4325-4329.
Clark, P.L., Liu, Z.P., Zhang, J., and Gierasch, L.M.(1996). Intrinsic tryptophans of CRABPI as probes of structure and folding.
Protein Sci 5, 1108-1117.
Cowan, P.J., Shinkel, T.A., Witort, E.J., Barlow, H., Pearse, M.J., and d'Apice, A.J.(1996). Targeting gene expression to
endothelial cells in transgenic mice using the human intercellular adhesion molecule 2 promoter. Transplantation 62,
155-160.
Cullis, P.R. and Chonn, A.(1998). Recent advances in liposome technologies and their applications for systemic gene delivery.
Adv.Drug Deliv.Rev 30, 73-83.
Cussac, D., Vidal, M., Leprince, C., Liu, W.Q., Cornille, F., Tiraboschi, G., Roques, B.P., and Garbay, C.(1999). A Sos-derived
peptidimer blocks the Ras signaling pathway by binding both Grb2 SH3 domains and displays antiproliferative activity.
FASEB J. 13 , 31-38.
Darnell J., Lodish H., and Baltimore D.(1986). Molecular Cell Biology, first edition. W.H. Freeman and Company, New York,
NY 10010.
Dathe, M., Meyer, J., Beyermann, M., Maul, B., Hoischen, C., and Bienert, M.(2002). General aspects of peptide selectivity
towards lipid bilayers and cell membranes studied by variation of the structural parameters of amphipathic helical
model peptides. Biochim.Biophys.Acta. 1558, 171-186.
Dathe, M., Schumann, M., Wieprecht, T., Winkler, A., Beyermann, M., Krause, E., Matsuzaki, K., Murase, O., and Bienert,
M.(1996). Peptide helicity and membrane surface charge modulate the balance of electrostatic and hydrophobic
interactions with lipid bilayers and biological membranes. Biochemistry 35, 12612-12622.
Dathe, M. and Wieprecht, T.(1999). Structural features of helical antimicrobial peptides: their potential to modulate activity on
model membranes and biological cells. Biochim.Biophys.Acta 1462, 71-87.
96
Dathe, M., Wieprecht, T., Nikolenko, H., Handel, L., Maloy, W.L., MacDonald, D.L., Beyermann, M., and Bienert, M.(1997).
Hydrophobicity, hydrophobic moment and angle subtended by charged residues modulate antibacterial and haemolytic
activity of amphipathic helical peptides. FEBS Lett. 403, 208-212.
De Smedt, S.C., Demeester, J., and Hennink, W.E.(2000). Cationic polymer based gene delivery systems. Pharm.Res. 17, 113126.
Decout, A., Labeur, C., Goethals, M., Brasseur, R., Vandekerckhove, J., and Rosseneu, M.(1998). Enhanced efficiency of a
targeted fusogenic peptide. Biochim.Biophys.Acta 1372, 102-116.
Decout, A., Labeur, C., Vanloo, B., Goethals, M., Vandekerckhove, J., Brasseur, R., and Rosseneu, M.(1999). Contribution of the
hydrophobicity gradient to the secondary structure and activity of fusogenic peptides. Mol.Membr.Biol. 16, 237-246.
Dekie, L., Toncheva, V., Dubruel, P., Schacht, E.H., Barrett, L., and Seymour, L.W.(2000). Poly-L-glutamic acid derivatives as
vectors for gene therapy. J.Controlled Release 65, 187-202.
Derossi, D., Calvet, S., Trembleau, A., Brunissen, A., Chassaing, G., and Prochiantz, A.(1996). Cell internalization of the third
helix of the Antennapedia homeodomain is receptor-independent. J.Biol.Chem. 271, 18188-18193.
Derossi, D., Chassaing, G., and Prochiantz, A.(1998a). Trojan peptides: the penetratin system for intracellular delivery.
Trends.Cell Biol. 8, 84-87.
Derossi, D., Joliot, A.H., Chassaing, G., and Prochiantz, A.(1994). The third helix of the Antennapedia homeodomain translocates
through biological membranes. J.Biol.Chem. 269, 10444-10450.
Derossi, D., Williams, E.J., Green, P.J., Dunican, D.J., and Doherty, P.(1998b). Stimulation of mitogenesis by a cell-permeable PI
3-kinase binding peptide. Biochem.Biophys.Res.Commun. 251, 148-152.
Dom, G., Shaw-Jackson, C., Matis, C., Bouffioux, O., Picard, J.J., Prochiantz, A., Mingeot-Leclercq, M.P., Brasseur, R., and
Rezsohazy, R.(2003). Cellular uptake of Antennapedia Penetratin peptides is a two-step process in which phase transfer
precedes a tryptophan-dependent translocation. Nucleic.Acids.Res. 31, 556-561.
Drin, G., Cottin, S., Blanc, E., Rees, A.R., and Temsamani, J.(2003). Studies on the internalization mechanism of cationic cellpenetrating peptides. J.Biol.Chem. 278, 31192-31201.
Drin, G., Demene, H., Temsamani, J., and Brasseur, R.(2001a). Translocation of the pAntp peptide and its amphipathic analogue
AP-2AL. Biochemistry. 40, 1824-1834.
Drin, G., Mazel, M., Clair, P., Mathieu, D., Kaczorek, M., and Temsamani, J.(2001b). Physico-chemical requirements for cellular
uptake of pAntp peptide. Role of lipid-binding affinity. Eur.J.Biochem. 268, 1304-1314.
Dubruel, P.(2003). Studie van synthetische polymeren als vectoren voor gentherapie, Universiteit Gent, Gent.
Dubruel, P., Christiaens, B., Rosseneu, M., Vandekerckhove, J., Grooten, J., Goossens, V., and Schacht, E.(2004). Buffering
Properties of Cationic Polymethacrylates Are Not the Only Key to Successful Gene Delivery. Biomacromolecules. 5,
379-388.
Dubruel, P., Christiaens, B., Vanloo, B., Bracke, K., Rosseneu, M., Vandekerckhove, J., and Schacht, E.(2003a). Physicochemical
and biological evaluation of cationic polymethacrylates as vectors for gene delivery. Eur.J.Pharm.Sci. 18, 211-220.
Dubruel, P., De Strycker, J., Westbroek, P., Bracke, K., Temmerman, E., Vandervoort, J., Ludwig, A., and Schacht, E.(2002).
Synthetic polyamines as vectors for gene delivery. Polymer International 51, 948-957.
Dubruel, P., Dekie, L., Christiaens, B., Vanloo, B., Rosseneu, M., Vandekerckhove, J., Mannisto, M., Urtti, A., and Schacht,
E.(2003b). Poly-l-glutamic Acid Derivatives as Multifunctional Vectors for Gene Delivery. Part B. Biological
Evaluation. Biomacromolecules. 4, 1868
Dubruel, P., Dekie, L., and Schacht, E.(2003c). Poly-l-glutamic acid derivatives as multifunctional vectors for gene delivery. Part
A. Synthesis and physicochemical evaluation. Biomacromolecules. 4, 1168-1176.
Dubruel, P., Toncheva, V., and Schacht, E.H.(2000). pH sensitive vinyl copolymeren as vectors for gene therapy. Journal of
Bioactive and Compatible Polymers 15, 191-213.
Duncan, R.(2003). The dawning era of polymer therapeutics. Nat.Rev.Drug Discov. 2, 347-360.
97
Dunican, D.J. and Doherty, P.(2001). Designing cell-permeant phosphopeptides to modulate intracellular signaling pathways.
Biopolymers. 60, 45-60.
Dunlap, D.D., Maggi, A., Soria, M.R., and Monaco, L.(1997). Nanoscopic structure of DNA condensed for gene delivery.
Nucleic.Acids.Res. 25, 3095-3101.
Eguchi, A., Akuta, T., Okuyama, H., Senda, T., Yokoi, H., Inokuchi, H., Fujita, S., Hayakawa, T., Takeda, K., Hasegawa, M., and
Nakanishi, M.(2001). Protein transduction domain of HIV-1 Tat protein promotes efficient delivery of DNA into
mammalian cells. J.Biol.Chem. 276, 26204-26210.
Eisenberg, D., Weiss, R.M., and Terwilliger, T.C.(1984). The hydrophobic moment detects periodicity in protein hydrophobicity.
Proc.Natl.Acad.Sci U.S.A. 81, 140-144.
El Jastimi, R., Edwards, K., and Lafleur, M.(1999). Characterization of permeability and morphological perturbations induced by
nisin on phosphatidylcholine membranes. Biophys.J. 77, 842-852.
Ellens, H., Bentz, J., and Szoka, F.C.(1986). Fusion of phosphatidylethanolamine-containing liposomes and mechanism of the L
alpha-HII phase transition. Biochemistry 25, 4141-4147.
Elliott, G. and O'Hare, P.(1997). Intercellular trafficking and protein delivery by a herpesvirus structural protein. Cell 88, 223233.
Ensoli, B., Buonaguro, L., Barillari, G., Fiorelli, V., Gendelman, R., Morgan, R.A., Wingfield, P., and Gallo, R.C.(1993). Release,
uptake, and effects of extracellular human immunodeficiency virus type 1 Tat protein on cell growth and viral
transactivation. J.Virol. 67, 277-287.
Epand, R.M.(2003). Fusion peptides and the mechanism of viral fusion. Biochim.Biophys.Acta. 1614, 116-121.
Fahraeus, R., Paramio, J.M., Ball, K.L., Lain, S., and Lane, D.P.(1996). Inhibition of pRb phosphorylation and cell-cycle
progression by a 20-residue peptide derived from p16CDKN2/INK4A. Curr.Biol. 6, 84-91.
Fawell, S., Seery, J., Daikh, Y., Moore, C., Chen, L.L., Pepinsky, B., and Barsoum, J.(1994). Tat-mediated delivery of
heterologous proteins into cells. Proc.Natl.Acad.Sci U.S.A. 91, 664-668.
Felgner, J.H., Kumar, R., Sridhar, C.N., Wheeler, C.J., Tsai, Y.J., Border, R., Ramsey, P., Martin, M., and Felgner, P.L.(1994).
Enhanced gene delivery and mechanism studies with a novel series of cationic lipid formulations. J.Biol.Chem. 269,
2550-2561.
Felgner, P.L., Barenholz, Y., Behr, J.P., Cheng, S.H., Cullis, P., Huang, L., Jessee, J.A., Seymour, L., Szoka, F., Thierry, A.R.,
Wagner, E., and Wu, G.(1997). Nomenclature for synthetic gene delivery systems. Hum.Gene Ther. 8, 511-512.
Felgner, P.L., Gadek, T.R., Holm, M., Roman, R., Chan, H.W., Wenz, M., Northrop, J.P., Ringold, G.M., and Danielsen,
M.(1987). Lipofection: a highly efficient, lipid-mediated DNA-transfection procedure. Proc.Natl.Acad.Sci U.S.A. 84,
7413-7417.
Fischer, P.M., Zhelev, N.Z., Wang, S., Melville, J.E., Fahraeus, R., and Lane, D.P.(2000). Structure-activity relationship of
truncated and substituted analogues of the intracellular delivery vector Penetratin. J.Pept.Res. 55, 163-172.
Fischer, R., Kohler, K., Fotin-Mleczek, M., and Brock, R.(2004). A stepwise dissection of the intracellular fate of cationic cellpenetrating peptides. J.Biol.Chem. 279, 12625-35.
Fischer, R., Waizenegger, T., Kohler, K., and Brock, R.(2002). A quantitative validation of fluorophore-labelled cell-permeable
peptide conjugates: fluorophore and cargo dependence of import. Biochim.Biophys.Acta. 1564, 365-374.
Fraenkel, E. and Pabo, C.O.(1998). Comparison of X-ray and NMR structures for the Antennapedia homeodomain-DNA complex.
Nat.Struct.Biol. 5, 692-697.
Frankel, A.D. and Pabo, C.O.(1988). Cellular uptake of the tat protein from human immunodeficiency virus. Cell 55, 1189-1193.
Garnett, M.C.(1999). Gene-delivery systems using cationic polymers. Crit.Rev.Ther.Drug Carrier.Syst. 16, 147-207.
Gazit, E., Boman, A., Boman, H.G., and Shai, Y.(1995). Interaction of the mammalian antibacterial peptide cecropin P1 with
phospholipid vesicles. Biochemistry 34, 11479-11488.
Gehring, W.J., Affolter, M., and Burglin, T.(1994a). Homeodomain proteins. Annu.Rev.Biochem. 63, 487-526.
98
Gehring, W.J., Muller, M., Affolter, M., Percival-Smith, A., Billeter, M., Qian, Y.Q., Otting, G., and Wuthrich, K.(1990). The
structure of the homeodomain and its functional implications. Trends Genet. 6, 323-329.
Gehring, W.J., Qian, Y.Q., Billeter, M., Furukubo-Tokunaga, K., Schier, A.F., Resendez-Perez, D., Affolter, M., Otting, G., and
Wuthrich, K.(1994b). Homeodomain-DNA recognition. Cell 78, 211-223.
Glimm, H., Kiem, H.P., Darovsky, B., Storb, R., Wolf, J., Diehl, V., Mertelsmann, R., and Von Kalle, C.(1997). Efficient gene
transfer in primitive CD34+/CD38lo human bone marrow cells reselected after long-term exposure to GALVpseudotyped retroviral vector. Hum.Gene Ther. 8, 2079-2086.
Godbey, W.T., Barry, M.A., Saggau, P., Wu, K.K., and Mikos, A.G.(2000). Poly(ethylenimine)-mediated transfection: a new
paradigm for gene delivery. J.Biomed.Mater.Res. 51, 321-328.
Godbey, W.T. and Mikos, A.G.(2001). Recent progress in gene delivery using non-viral transfer complexes. J.Control.Release.
72, 115-125.
Godbey, W.T., Wu, K.K., and Mikos, A.G.(1999a). Poly(ethylenimine) and its role in gene delivery. J.Control.Release. 60, 149160.
Godbey, W.T., Wu, K.K., and Mikos, A.G.(1999b). Tracking the intracellular path of poly(ethylenimine)/DNA complexes for
gene delivery. Proc.Natl.Acad.Sci.U.S.A. 96, 5177-5181.
Godbey, W.T., Wu, K.K., and Mikos, A.G.(2001). Poly(ethylenimine)-mediated gene delivery affects endothelial cell function and
viability. Biomaterials. 22, 471-480.
Graham, F.L. and van der Eb, A.J.(1973). A new technique for the assay of infectivity of human adenovirus 5 DNA. Virology 52,
456-467.
Gratton, J.P., Yu, J., Griffith, J.W., Babbitt, R.W., Scotland, R.S., Hickey, R., Giordano, F.J., and Sessa, W.C.(2003). Cellpermeable peptides improve cellular uptake and therapeutic gene delivery of replication-deficient viruses in cells and in
vivo. Nat.Med. 9, 357-362.
Green, M. and Loewenstein, P.M.(1988). Autonomous functional domains of chemically synthesized human immunodeficiency
virus tat trans-activator protein. Cell 55, 1179-1188.
Greenwood, J., Amos, C.L., Walters, C.E., Couraud, P.O., Lyck, R., Engelhardt, B., and Adamson, P.(2003). Intracellular domain
of brain endothelial intercellular adhesion molecule-1 is essential for T lymphocyte-mediated signaling and migration.
J.Immunol. 171, 2099-2108.
Gregoriadis, G.(1995). Engineering liposomes for drug delivery: progress and problems. Trends Biotechnol. 13, 527-537.
Gregoriadis, G., McCormack, B., Obrenovic, M., Saffie, R., Zadi, B., and Perrie, Y.(1999). Vaccine entrapment in liposomes.
Methods 19, 156-162.
Hallbrink, M., Floren, A., Elmquist, A., Pooga, M., Bartfai, T., and Langel, U.(2001). Cargo delivery kinetics of cell-penetrating
peptides. Biochim.Biophys.Acta. 1515, 101-109.
Harder, T., Scheiffele, P., Verkade, P., and Simons, K.(1998). Lipid domain structure of the plasma membrane revealed by
patching of membrane components. J.Cell Biol. 141, 929-942.
Harder, T. and Simons, K.(1997). Caveolae, DIGs, and the dynamics of sphingolipid-cholesterol microdomains. Curr.Opin.Cell
Biol. 9, 534-542.
Harris, J.M. and Chess, R.B.(2003). Effect of pegylation on pharmaceuticals. Nat.Rev.Drug Discov. 2, 214-221.
Hart, S.L., Harbottle, R.P., Cooper, R., Miller, A., Williamson, R., and Coutelle, C.(1995). Gene delivery and expression mediated
by an integrin-binding peptide. Gene Ther. 2, 552-554.
Hasselbacher, C.A., Rusinova, E., Waxman, E., Rusinova, R., Kohanski, R.A., Lam, W., Guha, A., Du, J., Lin, T.C., and
Polikarpov, I.(1995). Environments of the four tryptophans in the extracellular domain of human tissue factor:
comparison of results from absorption and fluorescence difference spectra of tryptophan replacement mutants with the
crystal structure of the wild-type protein. Biophys.J. 69, 20-29.
Hawiger, J.(1999). Noninvasive intracellular delivery of functional peptides and proteins. Curr.Opin.Chem.Biol. 3, 89-94.
99
Helland, D.E., Welles, J.L., Caputo, A., and Haseltine, W.A.(1991). Transcellular transactivation by the human immunodeficiency
virus type 1 tat protein. J.Virol. 65, 4547-4549.
Herbert, T.P., Fahraeus, R., Prescott, A., Lane, D.P., and Proud, C.G.(2000). Rapid induction of apoptosis mediated by peptides
that bind initiation factor eIF4E. Curr.Biol. 10, 793-796.
Ho, A., Schwarze, S.R., Mermelstein, S.J., Waksman, G., and Dowdy, S.F.(2001). Synthetic protein transduction domains:
enhanced transduction potential in vitro and in vivo. Cancer Res. 61, 474-477.
Ignatovich, I.A., Dizhe, E.B., Pavlotskaya, A.V., Akifiev, B.N., Burov, S.V., Orlov, S.V., and Perevozchikov, A.P.(2003).
Complexes of plasmid DNA with basic domain 47-57 of the HIV-1 Tat protein are transferred to mammalian cells by
endocytosis-mediated pathways. J.Biol.Chem. 278, 42625-42636.
Joliot, A., Maizel, A., Rosenberg, D., Trembleau, A., Dupas, S., Volovitch, M., and Prochiantz, A.(1998). Identification of a signal
sequence necessary for the unconventional secretion of Engrailed homeoprotein. Curr.Biol. 8, 856-863.
Joliot, A., Pernelle, C., Deagostini-Bazin, H., and Prochiantz, A.(1991a). Antennapedia homeobox peptide regulates neural
morphogenesis. Proc.Natl.Acad.Sci.U.S.A. 88, 1864-1868.
Joliot, A. and Prochiantz, A.(2004). Transduction peptides: from technology to physiology. Nat.Cell Biol. 6, 189-196.
Joliot, A., Trembleau, A., Raposo, G., Calvet, S., Volovitch, M., and Prochiantz, A.(1997). Association of Engrailed
homeoproteins with vesicles presenting caveolae-like properties. Development 124, 1865-1875.
Joliot, A.H., Triller, A., Volovitch, M., Pernelle, C., and Prochiantz, A.(1991b). alpha-2,8-Polysialic acid is the neuronal surface
receptor of antennapedia homeobox peptide. New Biol. 3, 1121-1134.
Journal of Gene Medicine website: www.wiley.co.uk/genetherapy/clinical/
Vectors used in gene therapy clinical trials (2004).
Kanovsky, M., Michl, J., Botzolaki, G., Morin, J., Kovac, C., Chung, D.L., Chie, L., Friedman, F.K., and Pincus, M.R.(2003).
Peptides designed from molecular modeling studies of the ras-p21 protein induce phenotypic reversion of a pancreatic
carcinoma cell line but have no effect on normal pancreatic acinar cell growth. Cancer Chemother.Pharmacol. 52,
202-208.
Kanovsky, M., Raffo, A., Drew, L., Rosal, R., Do, T., Friedman, F.K., Rubinstein, P., Visser, J., Robinson, R., Brandt-Rauf, P.W.,
Michl, J., Fine, R.L., and Pincus, M.R.(2001). Peptides from the amino terminal mdm-2-binding domain of p53,
designed from conformational analysis, are selectively cytotoxic to transformed cells. Proc.Natl.Acad.Sci U.S.A. 98,
12438-12443.
Kasahara, N., Dozy, A.M., and Kan, Y.W.(1994). Tissue-specific targeting of retroviral vectors through ligand-receptor
interactions. Science 266, 1373-1376.
Kato, T., Lee, S., Ono, S., Agawa, Y., Aoyagi, H., Ohno, M., and Nishino, N.(1991). Conformational studies of amphipathic
alpha-helical peptides containing an amino acid with a long alkyl chain and their anchoring to lipid bilayer liposomes.
Biochim.Biophys.Acta 1063, 191-196.
Katsu, T., Kuroko, M., Morikawa, T., Sanchika, K., Fujita, Y., Yamamura, H., and Uda, M.(1989). Mechanism of membrane
damage induced by the amphipathic peptides gramicidin S and melittin. Biochim.Biophys.Acta 983, 135-141.
Kaufman, T.C., Seeger, M.A., and Olsen, G.(1990). Molecular and genetic organization of the antennapedia gene complex of
Drosophila melanogaster. Adv.Genet. 27, 309-362.
Kichler, A., Leborgne, C., Marz, J., Danos, O., and Bechinger, B.(2003). Histidine-rich amphipathic peptide antibiotics promote
efficient delivery of DNA into mammalian cells. Proc.Natl.Acad.Sci.U.S.A. 100, 1564-1568.
Kircheis, R., Kichler, A., Wallner, G., Kursa, M., Ogris, M., Felzmann, T., Buchberger, M., and Wagner, E.(1997). Coupling of
cell-binding ligands to polyethylenimine for targeted gene delivery. Gene Ther. 4, 409-418.
Klemm, A.R., Young, D., and Lloyd, J.B.(1998). Effects of polyethyleneimine on endocytosis and lysosome stability.
Biochem.Pharmacol. 56, 41-46.
Koppelhus, U., Awasthi, S.K., Zachar, V., Holst, H.U., Ebbesen, P., and Nielsen, P.E.(2002). Cell-dependent differential cellular
uptake of PNA, peptides, and PNA-peptide conjugates. Antisense.Nucleic.Acid.Drug Dev. 12, 51-63.
Kozlovsky, Y. and Kozlov, M.M.(2002). Stalk model of membrane fusion: solution of energy crisis. Biophys.J. 82, 882-895.
100
Langel, U.(2002). Cell-penetrating peptides, processes and applications, CRC Press: Boca Raton, FL edition.
Lau, W.L., Ege, D.S., Lear, J.D., Hammer, D.A., and DeGrado, W.F.(2004). Oligomerization of fusogenic peptides promotes
membrane fusion by enhancing membrane destabilization. Biophys.J. 86, 272-284.
Le Roux, I., Duharcourt, S., Volovitch, M., Prochiantz, A., and Ronchi, E.(1995). Promoter-specific regulation of gene expression
by an exogenously added homedomain that promotes neurite growth. FEBS Lett. 368, 311-314.
Le Roux, I., Joliot, A.H., Bloch-Gallego, E., Prochiantz, A., and Volovitch, M.(1993). Neurotrophic activity of the Antennapedia
homeodomain depends on its specific DNA-binding properties. Proc.Natl.Acad.Sci.U.S.A. 90, 9120-9124.
Lee, K.D., Oh, Y.K., Portnoy, D.A., and Swanson, J.A.(1996). Delivery of macromolecules into cytosol using liposomes
containing hemolysin from Listeria monocytogenes. J.Biol.Chem. 271, 7249-7252.
Lehrman, S.R., Tuls, J.L., and Lund, M.(1990). Peptide alpha-helicity in aqueous trifluoroethanol: correlations with predicted
alpha-helicity and the secondary structure of the corresponding regions of bovine growth hormone. Biochemistry 29,
5590-5596.
Lentz, B.R., Siegel, D.P., and Malinin, V.(2002). Filling potholes on the path to fusion pores. Biophys.J. 82, 555-557.
Letoha, T., Gaal, S., Somlai, C., Czajlik, A., Perczel, A., and Penke, B.(2003). Membrane translocation of penetratin and its
derivatives in different cell lines. J.Mol.Recognit. 16, 272-279.
Leventis, R. and Silvius, J.R.(1990). Interactions of mammalian cells with lipid dispersions containing novel metabolizable
cationic amphiphiles. Biochim.Biophys.Acta 1023, 124-132.
Lewin, M., Carlesso, N., Tung, C.H., Tang, X.W., Cory, D., Scadden, D.T., and Weissleder, R.(2000). Tat peptide-derivatized
magnetic nanoparticles allow in vivo tracking and recovery of progenitor cells. Nat.Biotechnol. 18, 410-414.
Li, Y., Han, X., and Tamm, L.K.(2003). Thermodynamics of fusion peptide-membrane interactions. Biochemistry 42, 7245-7251.
Li, Y., Rosal, R.V., Brandt-Rauf, P.W., and Fine, R.L.(2002). Correlation between hydrophobic properties and efficiency of
carrier-mediated membrane transduction and apoptosis of a p53 C-terminal peptide. Biochem.Biophys.Res.Commun.
298, 439-449.
Lin, X., Nelson, P., and Gelman, I.H.(2000). SSeCKS, a major protein kinase C substrate with tumor suppressor activity, regulates
G(1)-->S progression by controlling the expression and cellular compartmentalization of cyclin D. Mol.Cell Biol. 20,
7259-7272.
Lin, Y.Z., Yao, S.Y., Veach, R.A., Torgerson, T.R., and Hawiger, J.(1995). Inhibition of nuclear translocation of transcription
factor NF-kappa B by a synthetic peptide containing a cell membrane-permeable motif and nuclear localization
sequence. J.Biol.Chem. 270, 14255-14258.
Lindberg, M., Biverstahl, H., Graslund, A., and Maler, L.(2003). Structure and positioning comparison of two variants of
penetratin in two different membrane mimicking systems by NMR. Eur.J.Biochem. 270, 3055-3063.
Lindgren, M., Hallbrink, M., Prochiantz, A., and Langel, U.(2000). Cell-penetrating peptides.
2000.Mar.;21.(3.):99.-103. 21, 99-103.
Trends.Pharmacol.Sci
Lollo, C.P., Banaszczyk, M.G., and Chiou, H.C.(2000). Obstacles and advances in non-viral gene delivery. Curr.Opin.Mol.Ther.
2, 136-142.
London, E.(1994). Analyzing the structure of polypeptides in membranes by fluorescence quenching. Biophys.J. 67, 1368-1369.
Lucas, W.J., Bouche-Pillon, S., Jackson, D.P., Nguyen, L., Baker, L., Ding, B., and Hake, S.(1995). Selective trafficking of
KNOTTED1 homeodomain protein and its mRNA through plasmodesmata. Science 270, 1980-1983.
Ludtke, S., He, K., and Huang, H.(1995). Membrane thinning caused by magainin 2. Biochemistry 34, 16764-16769.
Ludtke, S.J., He, K., Heller, W.T., Harroun, T.A., Yang, L., and Huang, H.W.(1996). Membrane pores induced by magainin.
Biochemistry 35, 13723-13728.
Lukaszczyk, J. and Schacht, E.(1992). Some novel applications of synthetic polymers in drug delivery. Polim.Med. 22, 3-29.
101
Lundberg, P. and Langel, U.(2003). A brief introduction to cell-penetrating peptides. J.Mol.Recognit. 16, 227-233.
Magzoub, M., Eriksson, L.E., and Graslund, A.(2002). Conformational states of the cell-penetrating peptide penetratin when
interacting with phospholipid vesicles: effects of surface charge and peptide concentration. Biochim.Biophys.Acta.
1563, 53-63.
Magzoub, M., Eriksson, L.E., and Graslund, A.(2003). Comparison of the interaction, positioning, structure induction and
membrane perturbation of cell-penetrating peptides and non-translocating variants with phospholipid vesicles.
Biophys.Chem. 103, 271-288.
Magzoub, M., Kilk, K., Eriksson, L.E., Langel, U., and Graslund, A.(2001). Interaction and structure induction of cell-penetrating
peptides in the presence of phospholipid vesicles. Biochim.Biophys.Acta. 1512, 77-89.
Maher, P. and Singer, S.J.(1984). Structural changes in membranes produced by the binding of small amphipathic molecules.
Biochemistry 23, 232-240.
Maizel, A., Bensaude, O., Prochiantz, A., and Joliot, A.(1999). A short region of its homeodomain is necessary for engrailed
nuclear export and secretion. Development 126, 3183-3190.
Maizel, A., Tassetto, M., Filhol, O., Cochet, C., Prochiantz, A., and Joliot, A.(2002). Engrailed homeoprotein secretion is a
regulated process. Development. 129, 3545-3553.
Markin, V.S. and Albanesi, J.P.(2002). Membrane fusion: stalk model revisited. Biophys.J. 82, 693-712.
Martin, I., Ruysschaert, J., and Epand, R.M.(1999). Role of the N-terminal peptides of viral envelope proteins in membrane fusion.
Adv.Drug Deliv.Rev 38, 233-255.
Matsuoka, K. and Bednarek, S.Y.(1998). Protein transport within the plant cell endomembrane system: an update.
Curr.Opin.Plant Biol. 1, 463-469.
Matsuzaki, K.(1999). Why and how are peptide-lipid interactions utilized for self-defense? Magainins and tachyplesins as
archetypes. Biochim.Biophys.Acta 1462, 1-10.
Matsuzaki, K., Yoneyama, S., and Miyajima, K.(1997). Pore formation and translocation of melittin. Biophys.J. 73, 831-838.
Mazel, M., Clair, P., Rousselle, C., Vidal, P., Scherrmann, J.M., Mathieu, D., and Temsamani, J.(2001). Doxorubicin-peptide
conjugates overcome multidrug resistance. Anticancer Drugs. 12, 107-116.
Mi, Z., Mai, J., Lu, X., and Robbins, P.D.(2000). Characterization of a class of cationic peptides able to facilitate efficient protein
transduction in vitro and in vivo. Mol.Ther. 2, 339-347.
Minagawa, K., Matsuzawa, Y., Yoshikawa, K., Matsumoto, M., and Doi, M.(1991). Direct observation of the biphasic
conformational change of DNA induced by cationic polymers. FEBS Lett. 295, 67-69.
Mittelman, J.M. and Gudkov, A.V.(1999). Generation of p53 suppressor peptide from the fragment of p53 protein. Somat.Cell
Mol.Genet. 25, 115-128.
Mori, A., Kennel, S.J., van Borssum, W., Scherphof, G.L., and Huang, L.(1995). Characterization of organ-specific
immunoliposomes for delivery of 3',5'-O-dipalmitoyl-5-fluoro-2'-deoxyuridine in a mouse lung-metastasis model.
Cancer Chemother.Pharmacol. 35, 447-456.
Morris, M.C., Chaloin, L., Choob, M., Archdeacon, J., Heitz, F., and Divita, G.(2004). Combination of a new generation of PNAs
with a peptide-based carrier enables efficient targeting of cell cycle progression. Gene Ther. 11, 757-64.
Morris, M.C., Chaloin, L., Heitz, F., and Divita, G.(2000). Translocating peptides and proteins and their use for gene delivery.
Curr.Opin.Biotechnol. 11, 461-466.
Morris, M.C., Chaloin, L., Mery, J., Heitz, F., and Divita, G.(1999). A novel potent strategy for gene delivery using a single
peptide vector as a carrier. Nucleic.Acids.Res. 27 , 3510-3517.
Morris, M.C., Depollier, J., Mery, J., Heitz, F., and Divita, G.(2001). A peptide carrier for the delivery of biologically active
proteins into mammalian cells. Nat.Biotechnol. 19, 1173-1176.
Morris, M.C., Vidal, P., Chaloin, L., Heitz, F., and Divita, G.(1997). A new peptide vector for efficient delivery of
oligonucleotides into mammalian cells. Nucleic.Acids.Res. 25, 2730-2736.
102
Mutoh, M., Lung, F.D., Long, Y.Q., Roller, P.P., Sikorski, R.S., and O'Connor, P.M.(1999). A p21(Waf1/Cip1)carboxyl-terminal
peptide exhibited cyclin-dependent kinase-inhibitory activity and cytotoxicity when introduced into human cells.
Cancer Res. 59, 3480-3488.
Nakanishi, M., Eguchi, A., Akuta, T., Nagoshi, E., Fujita, S., Okabe, J., Senda, T., and Hasegawa, M.(2003). Basic peptides as
functional components of non-viral gene transfer vehicles. Curr.Protein Pept.Sci. 4, 141-150.
Nakielny, S. and Dreyfuss, G.(1999). Transport of proteins and RNAs in and out of the nucleus. Cell 99, 677-690.
Nekhotiaeva, N., Elmquist, A., Rajarao, G.K., Hallbrink, M., Langel, U., and Good, L.(2003). Cell entry and antimicrobial
properties of eukaryotic cell-penetrating peptides. FASEB J. 18, 394-396.
Oehlke, J., Birth, P., Klauschenz, E., Wiesner, B., Beyermann, M., Oksche, A., and Bienert, M.(2002). Cellular uptake of antisense
oligonucleotides after complexing or conjugation with cell-penetrating model peptides. Eur.J.Biochem. 269, 40254032.
Oehlke, J., Scheller, A., Wiesner, B., Krause, E., Beyermann, M., Klauschenz, E., Melzig, M., and Bienert, M.(1998). Cellular
uptake of an alpha-helical amphipathic model peptide with the potential to deliver polar compounds into the cell
interior non-endocytically. Biochim.Biophys.Acta 1414, 127-139.
Ogris, M., Steinlein, P., Kursa, M., Mechtler, K., Kircheis, R., and Wagner, E.(1998). The size of DNA/transferrin-PEI complexes
is an important factor for gene expression in cultured cells. Gene Ther. 5, 1425-1433.
Orive, G., Hernandez, R.M., Rodriguez, G.A., Dominguez-Gil, A., and Pedraz, J.L.(2003). Drug delivery in biotechnology:
present and future. Curr.Opin.Biotechnol. 14, 659-664.
Otting, G., Qian, Y.Q., Muller, M., Affolter, M., Gehring, W., and Wuthrich, K.(1988). Secondary structure determination for the
Antennapedia homeodomain by nuclear magnetic resonance and evidence for a helix-turn-helix motif. EMBO J. 7,
4305-4309.
Parton, R.G. and Richards, A.A.(2003). Lipid rafts and caveolae as portals for endocytosis: new insights and common
mechanisms. Traffic. 4, 724-738.
Peck, D. and Isacke, C.M.(1998). Hyaluronan-dependent cell migration can be blocked by a CD44 cytoplasmic domain peptide
containing a phosphoserine at position 325. J.Cell Sci 111, 1595-1601.
Pellizzari, L., Tell, G., Fabbro, D., Pucillo, C., and Damante, G.(1997). Functional interference between contacting amino acids of
homeodomains. FEBS Lett. 407, 320-324.
Persson, D., Thoren, P.E., Herner, M., Lincoln, P., and Norden, B.(2003). Application of a novel analysis to measure the binding
of the membrane-translocating peptide penetratin to negatively charged liposomes. Biochemistry. 42, 421-429.
Persson, D., Thoren, P.E., and Norden, B.(2001). Penetratin-induced aggregation and subsequent dissociation of negatively
charged phospholipid vesicles. FEBS Lett. 505, 307-312.
Pierce, S.K.(2004). To cluster or not to cluster: FRETting over rafts. Nat.Cell Biol. 6, 180-181.
Pillot, T., Goethals, M., Vanloo, B., Talussot, C., Brasseur, R., Vandekerckhove, J., Rosseneu, M., and Lins, L.(1996). Fusogenic
properties of the C-terminal domain of the Alzheimer beta-amyloid peptide. J.Biol.Chem. 271, 28757-28765.
Pillot, T., Lins, L., Goethals, M., Vanloo, B., Baert, J., Vandekerckhove, J., Rosseneu, M., and Brasseur, R.(1997). The 118-135
peptide of the human prion protein forms amyloid fibrils and induces liposome fusion. J.Mol.Biol. 274, 381-393.
Pooga, M., Hallbrink, M., Zorko, M., and Langel, U.(1998a). Cell penetration by transportan. FASEB J. 12, 67-77.
Pooga, M., Lindgren, M., Hallbrink, M., Brakenhielm, E., and Langel, U.(1998b). Galanin-based peptides, galparan and
transportan, with receptor-dependent and independent activities. Ann.N.Y.Acad.Sci 863, 450-453.
Pooga, M., Soomets, U., Hallbrink, M., Valkna, A., Saar, K., Rezaei, K., Kahl, U., Hao, J.X., Xu, X.J., Wiesenfeld-Hallin, Z.,
Hokfelt, T., Bartfai, T., and Langel, U.(1998c). Cell penetrating PNA constructs regulate galanin receptor levels and
modify pain transmission in vivo. Nat.Biotechnol. 16, 857-861.
Potter, H.(1988). Electroporation in biology: methods, applications, and instrumentation. Anal.Biochem. 174, 361-373.
Pouton, C.W. and Seymour, L.W.(2001). Key issues in non-viral gene delivery. Adv.Drug Deliv.Rev. 46, 187-203.
103
Pozuelo, R.M., Peggie, M., Wong, B.H., Morrice, N., and MacKintosh, C.(2003). 14-3-3s regulate fructose-2,6-bisphosphate
levels by binding to PKB-phosphorylated cardiac fructose-2,6-bisphosphate kinase/phosphatase. EMBO J. 22, 35143523.
Prochiantz, A.(1996). Getting hydrophilic compounds into cells: lessons from homeopeptides. Curr.Opin.Neurobiol. 6, 629-634.
Prochiantz, A.(1998). Peptide nucleic acid smugglers [news]. Nat.Biotechnol. 16, 819-820.
Prochiantz, A.(1999). Homeodomain-derived peptides. In and out of the cells. Ann.N.Y.Acad.Sci 886 , 172-179.
Prochiantz, A.(2000). Messenger proteins: homeoproteins, TAT and others. Curr.Opin.Cell Biol. 12, 400-406.
Prochiantz, A. and Joliot, A.(2003). Can transcription factors function as cell-cell signalling molecules? Nat.Rev.Mol.Cell Biol. 4,
814-819.
Puyal, C., Maurin, L., Miquel, G., Bienvenue, A., and Philippot, J.(1994). Design of a short membrane-destabilizing peptide
covalently bound to liposomes. Biochim.Biophys.Acta 1195, 259-266.
Qian, Y.Q., Billeter, M., Otting, G., Muller, M., Gehring, W.J., and Wuthrich, K.(1989). The structure of the Antennapedia
homeodomain determined by NMR spectroscopy in solution: comparison with prokaryotic repressors. Cell 59, 573580.
Remy-Kristensen, A., Clamme, J.P., Vuilleumier, C., Kuhry, J.G., and Mely, Y.(2001). Role of endocytosis in the transfection of
L929 fibroblasts by polyethylenimine/DNA complexes. Biochim.Biophys.Acta. 1514, 21-32.
Remy, J.S., Kichler, A., Mordvinov, V., Schuber, F., and Behr, J.P.(1995). Targeted gene transfer into hepatoma cells with
lipopolyamine-condensed DNA particles presenting galactose ligands: a stage toward artificial viruses.
Proc.Natl.Acad.Sci U.S.A. 92, 1744-1748.
Richard, J.P., Melikov, K., Vives, E., Ramos, C., Verbeure, B., Gait, M.J., Chernomordik, L.V., and Lebleu, B.(2003). Cellpenetrating peptides. A reevaluation of the mechanism of cellular uptake. J.Biol.Chem. 278, 585-590.
Robinson, M.S.(1994). The role of clathrin, adaptors and dynamin in endocytosis. Curr.Opin.Cell Biol. 6, 538-544.
Roosbeek, S., Peelman, F., Verhee, A., Labeur, C., Castano, S., Lensink, M., Cirulli, C., Cochet, C., Vandekerckhove, J.,
Amoresano, A., Chimini, G., Tavernier, J., and Rosseneu, M.(2004). Phosphorylation by protein kinase CK2 modulates
the activity of tge ATP-binding cassette A1 (ABCA1) transporter. Submitted to J.Biol.Chem.
Roth, J.A., Nguyen, D., Lawrence, D.D., Kemp, B.L., Carrasco, C.H., Ferson, D.Z., Hong, W.K., Komaki, R., Lee, J.J., Nesbitt,
J.C., Pisters, K.M., Putnam, J.B., Schea, R., Shin, D.M., Walsh, G.L., Dolormente, M.M., Han, C.I., Martin, F.D., Yen,
N., Xu, K., Stephens, L.C., McDonnell, T.J., Mukhopadhyay, T., and Cai, D.(1996). Retrovirus-mediated wild-type
p53 gene transfer to tumors of patients with lung cancer. Nat.Med. 2, 985-991.
Rousselle, C., Clair, P., Lefauconnier, J.M., Kaczorek, M., Scherrmann, J.M., and Temsamani, J.(2000). New advances in the
transport of doxorubicin through the blood-brain barrier by a peptide vector-mediated strategy. Mol.Pharmacol. 57,
679-686.
Rudolph, C., Plank, C., Lausier, J., Schillinger, U., Muller, R.H., and Rosenecker, J.(2003). Oligomers of the arginine-rich motif
of the HIV-1 TAT protein are capable of transferring plasmid DNA into cells. J.Biol.Chem. 278, 11411-11418.
Salamon, Z., Lindblom, G., and Tollin, G.(2003). Plasmon-Waveguide Resonance and Impedance Spectroscopy Studies of the
Interaction between Penetratin and Supported Lipid Bilayer Membranes. Biophys.J. 84, 1796-1807.
Schaschke, N., Deluca, D., Assfalg-Machleidt, I., Hohneke, C., Sommerhoff, C.P., and Machleidt, W.(2002). Epoxysuccinyl
peptide-derived cathepsin B inhibitors: modulating membrane permeability by conjugation with the C-terminal
heptapeptide segment of penetratin. Biol.Chem. 383, 849-852.
Scheller, A., Oehlke, J., Wiesner, B., Dathe, M., Krause, E., Beyermann, M., Melzig, M., and Bienert, M.(1999). Structural
requirements for cellular uptake of alpha-helical amphipathic peptides. J.Pept.Sci. 5, 185-194.
Scheller, A., Wiesner, B., Melzig, M., Bienert, M., and Oehlke, J.(2000). Evidence for an amphipathicity independent cellular
uptake of amphipathic cell-penetrating peptides. Eur.J.Biochem. 267, 6043-6050.
Schmidt-Wolf, G.D. and Schmidt-Wolf, I.G.(2003). Non-viral and hybrid vectors in human gene therapy: an update. Trends
Mol.Med. 9, 67-72.
104
Schuette, C.G., Hatsuzawa, K., Margittai, M., Stein, A., Riedel, D., Kuster, P., Konig, M., Seidel, C., and Jahn, R.(2004).
Determinants of liposome fusion mediated by synaptic SNARE proteins. Proc.Natl.Acad.Sci U.S.A. 101, 2858-2863.
Schumann, M., Dathe, M., Wieprecht, T., Beyermann, M., and Bienert, M.(1997). The tendency of magainin to associate upon
binding to phospholipid bilayers. Biochemistry 36, 4345-4351.
Schwarze, S.R., Ho, A., Vocero-Akbani, A., and Dowdy, S.F.(1999). In vivo protein transduction: delivery of a biologically active
protein into the mouse. Science 285, 1569-1572.
Schwarze, S.R., Hruska, K.A., and Dowdy, S.F.(2000). Protein transduction: unrestricted delivery into all cells? Trends.Cell Biol.
10, 290-295.
Seelig, J. and Ganz, P.(1991). Nonclassical hydrophobic effect in membrane binding equilibria. Biochemistry 30, 9354-9359.
Sells, M.A., Li, J., and Chernoff, J.(1995). Delivery of protein into cells using polycationic liposomes. Biotechniques 19, 72-6, 78.
Shai, Y.(1999). Mechanism of the binding, insertion and destabilization of phospholipid bilayer membranes by alpha-helical
antimicrobial and cell non-selective membrane-lytic peptides. Biochim.Biophys.Acta 1462, 55-70.
Shogomori, H. and Brown, D.A.(2003). Use of detergents to study membrane rafts: the good, the bad, and the ugly. Biol.Chem.
384, 1259-1263.
Simons, K. and Ikonen, E.(1997). Functional rafts in cell membranes. Nature 387, 569-572.
Snyder, E.L. and Dowdy, S.F.(2001). Protein/peptide transduction domains: potential to deliver large DNA molecules into cells.
Curr.Opin.Mol.Ther. 3, 147-152.
Soomets, U., Hallbrink, M., Zorko, M., and Langel, U.(1997). From galanin and mastoparan to galparan and transportan.
Cur.Top.Pept.Prot.Res. 2, 83-113.
Sparrow, J.T., Edwards, V., Tung, C., Logan, M.J., Wadhwa, M.S., Duguid, J., and Smith, L.C.(1998). Synthetic peptide-based
DNA complexes for nonviral gene delivery. Adv.Drug Deliv.Rev 30, 115-131.
Stavridis, J.C., Deliconstantinos, G., Psallidopoulos, M.C., Armenakas, N.A., Hadjiminas, D.J., and Hadjiminas, J.(1986).
Construction of transferrin-coated liposomes for in vivo transport of exogenous DNA to bone marrow erythroblasts in
rabbits. Exp.Cell Res. 164, 568-572.
Stayton, P.S., Hoffman, A.S., Murthy, N., Lackey, C., Cheung, C., Tan, P., Klumb, L.A., Chilkoti, A., Wilbur, F.S., and Press,
O.W.(2000). Molecular engineering of proteins and polymers for targeting and intracellular delivery of therapeutics.
J.Control.Release. 65, 203-220.
Stephens, D.J. and Pepperkok, R.(2001). The many ways to cross the plasma membrane. Proc.Natl.Acad.Sci U.S.A. 98, 42954298.
Suzuki, T., Futaki, S., Niwa, M., Tanaka, S., Ueda, K., and Sugiura, Y.(2002). Possible existence of common internalization
mechanisms among arginine-rich peptides. J.Biol.Chem. 277, 2437-2443.
Terrone, D., Sang, S.L., Roudaia, L., and Silvius, J.R.(2003). Penetratin and related cell-penetrating cationic peptides can
translocate across lipid bilayers in the presence of a transbilayer potential. Biochemistry. 42, 13787-13799.
Terzi, E., Holzemann, G., and Seelig, J.(1997). Interaction of Alzheimer beta-amyloid peptide(1-40) with lipid membranes.
Biochemistry 36, 14845-14852.
Theodore, L., Derossi, D., Chassaing, G., Llirbat, B., Kubes, M., Jordan, P., Chneiweiss, H., Godement, P., and Prochiantz,
A.(1995). Intraneuronal delivery of protein kinase C pseudosubstrate leads to growth cone collapse. J.Neurosci. 15,
7158-7167.
Thoren, P.E., Persson, D., Isakson, P., Goksor, M., Onfelt, A., and Norden, B.(2003). Uptake of analogs of penetratin, Tat(48-60)
and oligoarginine in live cells. Biochem.Biophys.Res.Commun. 307, 100-107.
Thoren, P.E., Persson, D., Karlsson, M., and Norden, B.(2000). The antennapedia peptide penetratin translocates across lipid
bilayers - the first direct observation. FEBS Lett. 482, 265-268.
105
Torchilin, V.P., Levchenko, T.S., Rammohan, R., Volodina, N., Papahadjopoulos-Sternberg, B., and D'Souza, G.G.(2003). Cell
transfection in vitro and in vivo with nontoxic TAT peptide-liposome-DNA complexes. Proc.Natl.Acad.Sci U.S.A.
100, 1972-1977.
Torchilin, V.P., Rammohan, R., Weissig, V., and Levchenko, T.S.(2001). TAT peptide on the surface of liposomes affords their
efficient intracellular delivery even at low temperature and in the presence of metabolic inhibitors. Proc.Natl.Acad.Sci
U.S.A. 98, 8786-8791.
Troy, C.M., Derossi, D., Prochiantz, A., Greene, L.A., and Shelanski, M.L.(1996). Downregulation of Cu/Zn superoxide
dismutase leads to cell death via the nitric oxide-peroxynitrite pathway. J.Neurosci. 16, 253-261.
Tseng, Y.L., Liu, J.J., and Hong, R.L.(2002). Translocation of liposomes into cancer cells by cell-penetrating peptides penetratin
and tat: a kinetic and efficacy study. Mol.Pharmacol. 62, 864-872.
Udenfried S.(1969). Fluoprescence Assay in Biology and Medicine. Academic Press, New York. 248-281.
van de Wetering, P., Cherng, J.Y., Talsma, H., Crommelin, D.J., and Hennink, W.E.(1998). 2-(Dimethylamino)ethyl methacrylate
based (co)polymers as gene transfer agents. J.Control.Release 53, 145-153.
Vance, D.E. and Vance, J.(1991). New Comprehensive Biochemsitry Vol.20 - Biochemsitry of Lipids, Lipoproteins and
Membranes, Elsevier, Amsterdam London NewYork Tokyo.
Verma, I.M. and Somia, N.(1997). Gene therapy -- promises, problems and prospects. Nature 389, 239-242.
Vives, E.(2003). Cellular uptake of the Tat peptide: an endocytosis mechanism following ionic interactions. J.Mol.Recognit. 16,
265-271.
Vives, E., Brodin, P., and Lebleu, B.(1997). A truncated HIV-1 Tat protein basic domain rapidly translocates through the plasma
membrane and accumulates in the cell nucleus. J.Biol.Chem. 272, 16010-16017.
Vocero-Akbani, A.M., Heyden, N.V., Lissy, N.A., Ratner, L., and Dowdy, S.F.(1999). Killing HIV-infected cells by transduction
with an HIV protease-activated caspase-3 protein. Nat.Med. 5, 29-33.
Vogel, B.E., Lee, S.J., Hildebrand, A., Craig, W., Pierschbacher, M.D., Wong-Staal, F., and Ruoslahti, E.(1993). A novel integrin
specificity exemplified by binding of the alpha v beta 5 integrin to the basic domain of the HIV Tat protein and
vitronectin. J.Cell Biol. 121, 461-468.
Wagner, E.(1999). Application of membrane-active peptides for nonviral gene delivery. Adv.Drug Deliv.Rev 38, 279-289.
Waizenegger, T., Fischer, R., and Brock, R.(2002). Intracellular concentration measurements in adherent cells: a comparison of
import efficiencies of cell-permeable peptides. Biol.Chem. 383, 291-299.
White, S.H., Ladokhin, A.S., Jayasinghe, S., and Hristova, K.(2001). How membranes shape protein structure. J.Biol.Chem. 276,
32395-32398.
White,
S.H. and Wimley, W.C.(1999). Membrane
Annu.Rev.Biophys.Biomol.Struct. 28, 319-365.
protein
folding
and
stability:
physical
principles.
Wieprecht, T., Beyermann, M., and Seelig, J.(1999). Binding of antibacterial magainin peptides to electrically neutral membranes:
thermodynamics and structure. Biochemistry 38, 10377-10387.
Wieprecht, T., Dathe, M., Epand, R.M., Beyermann, M., Krause, E., Maloy, W.L., MacDonald, D.L., and Bienert, M.(1997a).
Influence of the angle subtended by the positively charged helix face on the membrane activity of amphipathic,
antibacterial peptides. Biochemistry 36, 12869-12880.
Wieprecht, T., Dathe, M., Krause, E., Beyermann, M., Maloy, W.L., MacDonald, D.L., and Bienert, M.(1997b). Modulation of
membrane activity of amphipathic, antibacterial peptides by slight modifications of the hydrophobic moment. FEBS
Lett. 417, 135-140.
Wieprecht, T., Dathe, M., Schumann, M., Krause, E., Beyermann, M., and Bienert, M.(1996). Conformational and functional
study of magainin 2 in model membrane environments using the new approach of systematic double-D-amino acid
replacement. Biochemistry 35, 10844-10853.
Wilschut, J. and Hoekstra, D.(1986). Membrane fusion: lipid vesicles as a model system. Chem.Phys.Lipids 40, 145-166.
106
Wimley, W.C. and White, S.H.(1996). Experimentally determined hydrophobicity scale for proteins at membrane interfaces.
Nat.Struct.Biol. 3, 842-848.
Xu, Z., Kukekov, N.V., and Greene, L.A.(2003). POSH acts as a scaffold for a multiprotein complex that mediates JNK activation
in apoptosis. EMBO J. 22, 252-261.
Yakymovych, I., Engstrom, U., Grimsby, S., Heldin, C.H., and Souchelnytskyi, S.(2002). Inhibition of transforming growth
factor-beta signaling by low molecular weight compounds interfering with ATP- or substrate-binding sites of the TGF
beta type I receptor kinase. Biochemistry. 41, 11000-11007.
Yamauchi, H., Kikuchi, H., Sawada, M., Tomikawa, M., and Hirota, S.(1994). Selective uptake of liposomes containing lactose
mono-fatty acid derivatives by hepatic parenchymal cells. J.Microencapsul. 11, 287-296.
Yang, L., Harroun, T.A., Weiss, T.M., Ding, L., and Huang, H.W.(2001). Barrel-stave model or toroidal model? A case study on
melittin pores. Biophys.J. 81, 1475-1485.
Yau, W.M., Wimley, W.C., Gawrisch, K., and White, S.H.(1998). The preference of tryptophan for membrane interfaces.
Biochemistry 37, 14713-14718.
Ziegler, A., Blatter, X.L., Seelig, A., and Seelig, J.(2003). Protein transduction domains of HIV-1 and SIV TAT interact with
charged lipid vesicles. Binding mechanism and thermodynamic analysis. Biochemistry 42, 9185-9194.
107
Cell penetrating peptides (CPP) are water soluble, non-toxic peptides, used for the
internalisation of hydrophilic cargo molecules into eukaryotic cells through energyindependent mechanisms. Penetratin is a 16-residue CPP (RQIKIWFQNRRMKWKK),
derived from helix 3 of the DNA-binding homeodomain of Antennapedia, a Drosophila
transcription factor. Despite the wide application field of the Penetratin vector, its
internalisation mechanism has yet to be unravelled.
The first aim of this thesis was the characterisation of this mechanism, by synthesis of
new Penetratin variants. Since tryptophan residues are known to favour peptide-lipid
interactions, the specific contribution of Trp48 and Trp56 was assessed by synthesis of
the single W48F- and W56F-Penetratin variants. At physiological pH, Penetratin is
positively charged (pI = 12.3) due to the presence of basic arginine and lysine residues.
The relative importance of these residues was investigated by substitutions by Ala. The
interactions of these variants with phospholipid vesicles were demonstrated by
physicochemical techniques. Penetratin monomers initially bind to lipid bilayers by
electrostatic interactions with negatively charged phospholipids, which induces the
peptides α-helical secondary structure.
Unlike ‘classical’ membrane destabilising
peptides (e.g. Melittin), Penetratin helices remain close to the water-lipid interface,
inducing only moderate membrane permeabilisation. The destabilisation relies on the
peptide depth of insertion into the lipid bilayer, which depends on residues Arg52,
Arg53, Lys55 and Lys57 in the vicinity of Trp56. The low membrane destabilisation
accounts for their low cellular toxicity of Penetratin peptides.
Membrane translocation of Penetratin peptides accounts for the efficient Penetratin
internalisation into MDCK cells at 37°C and 4°C and also depends upon the
environment of Trp56, while residue Trp48 also has a high functional importance.
The membrane interactions of Penetratin were used to increase endosomal escape and
to enhance transfection efficiency of polymethacrylate-DNA complexes in Cos-1 cells, to
levels comparable to polyethyleneimine- and Lipofectamine-DNA complexes. The
cellular toxicity of this transfection behicle remains nevertheless low.